CB304644

Overview
NameCB304644
Unique NameCB304644
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length477
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIC1_ARATH (Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabidopsis thaliana GN=AAT1 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 5.240e-58
Identity = 112/130 (86.15%), Postives = 120/130 (92.31%), Query Frame = -2
Query:   30 SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAPKYL 419
            SES+  RDVCIVGVARTPMGGFLGSLSS+ ATKLGS+AI  ALKRAN  P LVQEV FGNVLSANLGQAPARQAALGAGIPNSV+CTT+NKVC+SGMKAVM+AAQSIQLGIND+VVAGGMESMSN PKYL
Sbjct:    5 SESVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMESMSNTPKYL 134          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIC2_ARATH (Probable acetyl-CoA acetyltransferase, cytosolic 2 OS=Arabidopsis thaliana GN=At5g47720 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 9.250e-55
Identity = 105/136 (77.21%), Postives = 123/136 (90.44%), Query Frame = -2
Query:   30 MVPLEPSESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAPKYL 437
            M P    +S++ RDVC+VGVARTP+G FLGSLSS++AT+LGSIAI+ ALKRA+  P LV+EVFFGNVL+ANLGQAPARQAALGAGIP SV+CTTINKVC++GMK+VMLA+QSIQLG+NDIVVAGGMESMSN PKYL
Sbjct:    1 MAPPVSDDSLQPRDVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVFFGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDIVVAGGMESMSNVPKYL 136          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIL_SCHPO (Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe GN=erg10 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 1.872e-39
Identity = 83/122 (68.03%), Postives = 96/122 (78.69%), Query Frame = -2
Query:   33 DVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAPKY 398
            +V IV   RTPMG F GS +S+ ATKLGSIAI+ AL+R N KP  V EVF GNV+SANLGQ PARQ ALGAG+P S+VCTT+NKVC+SGMKA +L AQ+I  G  +IVVAGG ESMSNAP Y
Sbjct:    5 EVYIVSAVRTPMGSFGGSFASLPATKLGSIAIKGALERVNIKPSDVDEVFMGNVVSANLGQNPARQCALGAGLPRSIVCTTVNKVCASGMKATILGAQTIMTGNAEIVVAGGTESMSNAPYY 126          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIL_HUMAN (Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens GN=ACAT1 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 6.233e-35
Identity = 73/121 (60.33%), Postives = 91/121 (75.21%), Query Frame = -2
Query:   39 RDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAP 401
            ++V IV   RTP+G FLGSLS + ATKLGSIAI+ A+++A      V+E + GNVL    GQAP RQA LGAG+P S  CTTINKVC+SGMKA+M+A+QS+  G  D++VAGGMESMSN P
Sbjct:   40 KEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVP 160          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIL_BOVIN (Acetyl-CoA acetyltransferase, mitochondrial OS=Bos taurus GN=ACAT1 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 6.233e-35
Identity = 73/120 (60.83%), Postives = 91/120 (75.83%), Query Frame = -2
Query:   39 DVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAP 398
            +V IV   RTP+G FLGSLSS+ ATKLGSIAI+ A+++A      V+E + GNVL    GQAP RQA LGAG+P S  CTTINKVC+SGMKA+M+A+Q++  G  D++VAGGMESMSN P
Sbjct:   36 EVVIVSAIRTPIGSFLGSLSSLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQNLMCGHQDVMVAGGMESMSNVP 155          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIL_RAT (Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus GN=Acat1 PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.389e-34
Identity = 71/120 (59.17%), Postives = 91/120 (75.83%), Query Frame = -2
Query:   39 DVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAP 398
            DV IV   RTP+G FLGSL+S  ATKLG+IAI+ A+++A      V+EV+ GNV+    GQAP RQA LGAG+P +  CTT+NKVC+SGMKA+M+A+QS+  G  D++VAGGMESMSN P
Sbjct:   38 DVVIVSATRTPIGSFLGSLASQPATKLGTIAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPIATPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVP 157          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIL1_DICDI (Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum GN=DDB_G0271544 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 4.040e-34
Identity = 79/140 (56.43%), Postives = 92/140 (65.71%), Query Frame = -2
Query:   33 KILFSMVPLEPSESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAPKY 452
            K+L S V    + +     V IV   RTP+G   GSLS++  TKL SI IE A+KRA  KP  V E   GNV+SANLGQAPARQ ALGAG+    + TTINKVCSSGMKA++  AQSI LG +  VVAGG ESMS  P Y
Sbjct:    7 KVLNSNVKRMYTTAKNLESVVIVSAVRTPIGSIGGSLSTIPGTKLSSITIEEAVKRAGIKPSDVDEAIIGNVISANLGQAPARQCALGAGLEQKTITTTINKVCSSGMKAIVFGAQSIALGHSKTVVAGGFESMSQVPYY 146          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIL_MOUSE (Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus GN=Acat1 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 9.001e-34
Identity = 70/120 (58.33%), Postives = 90/120 (75.00%), Query Frame = -2
Query:   39 DVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAP 398
            +V IV   RTP+G FLGSL+S  ATKLG+ AI+ A+++A      V+EV+ GNV+    GQAP RQA LGAG+P S  CTT+NKVC+SGMKA+M+A+QS+  G  D++VAGGMESMSN P
Sbjct:   38 EVVIVSAIRTPIGSFLGSLASQPATKLGTAAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPISTPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVP 157          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THIL_XENTR (Acetyl-CoA acetyltransferase, mitochondrial OS=Xenopus tropicalis GN=acat1 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.535e-33
Identity = 74/120 (61.67%), Postives = 90/120 (75.00%), Query Frame = -2
Query:   39 DVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAP 398
            +V I   ARTP+G F GSLSS+ ATKLGSIAI+ A++RA      V+EV+ GNVL A  GQAP+RQA LGAG+  S   TTINKVC+SGMK++MLAAQS+  G   ++VAGGMESMSN P
Sbjct:   34 EVVIASAARTPIGSFQGSLSSLPATKLGSIAIKAAVERAGIPGDEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSIMLAAQSLMCGHQQVMVAGGMESMSNVP 153          
BLAST of CB304644 vs. ExPASy Swiss-Prot
Match: THILB_XENLA (Acetyl-CoA acetyltransferase B, mitochondrial OS=Xenopus laevis GN=acat1-B PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.005e-33
Identity = 74/120 (61.67%), Postives = 90/120 (75.00%), Query Frame = -2
Query:   39 DVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANAKPLLVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGMESMSNAP 398
            +V I   ARTP+G F G+LSS+ ATKLGSIAI+ A++RA      V+EV+ GNVL A  GQAP+RQA LGAG+  S   TTINKVC+SGMK+VMLAAQS+  G   ++VAGGMESMSN P
Sbjct:   34 EVVIASAARTPIGSFQGTLSSLPATKLGSIAIKAAVERAGIPADEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSVMLAAQSLMCGHQQVMVAGGMESMSNVP 153          
The following BLAST results are available for this feature:
BLAST of CB304644 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
THIC1_ARATH5.240e-5886.15Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabi... [more]
THIC2_ARATH9.250e-5577.21Probable acetyl-CoA acetyltransferase, cytosolic 2... [more]
THIL_SCHPO1.872e-3968.03Acetyl-CoA acetyltransferase OS=Schizosaccharomyce... [more]
THIL_HUMAN6.233e-3560.33Acetyl-CoA acetyltransferase, mitochondrial OS=Hom... [more]
THIL_BOVIN6.233e-3560.83Acetyl-CoA acetyltransferase, mitochondrial OS=Bos... [more]
THIL_RAT1.389e-3459.17Acetyl-CoA acetyltransferase, mitochondrial OS=Rat... [more]
THIL1_DICDI4.040e-3456.43Probable acetyl-CoA acetyltransferase OS=Dictyoste... [more]
THIL_MOUSE9.001e-3458.33Acetyl-CoA acetyltransferase, mitochondrial OS=Mus... [more]
THIL_XENTR1.535e-3361.67Acetyl-CoA acetyltransferase, mitochondrial OS=Xen... [more]
THILB_XENLA2.005e-3361.67Acetyl-CoA acetyltransferase B, mitochondrial OS=X... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IaR_H05 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IaR_H05 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304644 ID=CB304644|Name=CB304644|organism=Citrus sinensis|type=EST|length=477bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTGTTAGATACTTGGGCGCATTGGA
CATGCTTTCCATGCCACCCGCAACAACAATATCATTGATACCCAATTGAA
TACTCTGTGCAGCAAGCATTACAGCTTTCATCCCAGATGAACAGACTTTG
TTAATAGTGGTGCATACGACAGAATTAGGAATCCCAGCACCTAAGGCGGC
CTGTCTAGCGGGAGCCTGTCCTAAATTGGCGCTAAGAACGTTCCCAAAGA
AAACTTCTTGCACAAGGAGTGGTTTCGCGTTGGCCCTCTTAAGAGCACAT
TCGATAGCAATGGAACCCAGCTTTGTAGCTGAAACAGACGAGAGCGAGCC
AAGAAAGCCTCCCATTGGTGTACGTGCAACACCCACAATACAAACATCTC
GTGCTTTGATAGATTCTGAAGGTTCTAAAGGCACCATGCTAAATAGTATC
TTCAAAGAATCTTTAACTTTAAACCCC
back to top