CB304645

Overview
NameCB304645
Unique NameCB304645
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length580
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5788 contig Csv1_Contig5788:266..834. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304645 vs. ExPASy Swiss-Prot
Match: KING1_ARATH (SNF1-related protein kinase regulatory subunit gamma 1 OS=Arabidopsis thaliana GN=KING1 PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 4.692e-21
Identity = 55/158 (34.81%), Postives = 89/158 (56.33%), Query Frame = -3
Query:  120 SDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFRQLPVRDFMNAVVPTTPDSGKVNPP-----ITCKLESTLGSVIPSLASKSVPRIYXXXXXXXXXXXVIPLRDVISCFIFEPPNHLDNYF 578
            S++GLP MS D +I I  +E +L+AFK M+   IGGIPV+E   +K VGN+S+RD++ LL  PE++ ++R +  ++F+ +V       G  + P     I C    TL  +I  L ++ + RIY           +I LRD+I+  + EP  +  ++F
Sbjct:  256 SEVGLPIMSKDHIIKIYEDEPVLQAFKLMRRKRIGGIPVIERNSEKPVGNISLRDVQFLLTAPEIYHDYRSITTKNFLVSVREHLEKCGDTSAPIMSGVIACTKNHTLKELILMLDAEKIHRIY-VVDDFGNLEGLITLRDIIARLVHEPSGYFGDFF 412          
The following BLAST results are available for this feature:
BLAST of CB304645 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
KING1_ARATH4.692e-2134.81SNF1-related protein kinase regulatory subunit gam... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IaR_H06 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IaR_H06 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304645 ID=CB304645|Name=CB304645|organism=Citrus sinensis|type=EST|length=580bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGTCGCAGCCAAATTGATTT
TATTCAAGCTATCAGAGATCTTCTATAACAAAAATCTCACTGGTTCAACA
GATCTTTGACCGAAAACCCAAAGTAGTTGTCCAAATGGTTAGGGGGTTCA
AAGATGAAGCAAGAGATTACATCTCTGAGTGGAATTACACCAACAACTTC
AGCTTCCTCGCCAGCTACCACATAAATTCTGGGAACAGACTTGGAAGCAA
GACTGGGGATCACACTACCGAGAGTTGACTCCAGCTTGCATGTTATTGGC
GGGTTGACTTTCCCAGAATCTGGGGTAGTTGGTACCACAGCATTCATGAA
ATCTCTGACTGGAAGCTGCCTGAAATTGGAGAAGAGTTCTGGTTTGAGCA
GCAAGTGTCTGATATCTCTTATGCTTACATTTCCCACAATTTTCTTTTGT
TGTCCCTCTACGACTGGAATGCCACCAATATTGTTATCTTTCATCCGTTT
GAAAGCTTCCAGAATCAGTTCATTGCTCTGTATGGTAATAACCTCATCAG
AAGACATGAACGGAAGCCCTAGATCAGAAA
back to top