CB304657

Overview
NameCB304657
Unique NameCB304657
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length581
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2673 contig Csv1_Contig2673:872..1451. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_SPIOL (Calmodulin OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_MEDSA (Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_MALDO (Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_MAIZE (Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_LILLO (Calmodulin OS=Lilium longiflorum PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_HORVU (Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_HELAN (Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_EUPCH (Calmodulin OS=Euphorbia characias PE=2 SV=4)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM_BRYDI (Calmodulin OS=Bryonia dioica PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304657 vs. ExPASy Swiss-Prot
Match: CALM7_ARATH (Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.247e-29
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = -2
Query:  389 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 580
            LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   86 LKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
The following BLAST results are available for this feature:
BLAST of CB304657 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 204
Match NameE-valueIdentityDescription
CALM_SPIOL1.247e-29100.00Calmodulin OS=Spinacia oleracea PE=1 SV=2[more]
CALM_MEDSA1.247e-29100.00Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2[more]
CALM_MALDO1.247e-29100.00Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2[more]
CALM_MAIZE1.247e-29100.00Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2[more]
CALM_LILLO1.247e-29100.00Calmodulin OS=Lilium longiflorum PE=2 SV=2[more]
CALM_HORVU1.247e-29100.00Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2[more]
CALM_HELAN1.247e-29100.00Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3[more]
CALM_EUPCH1.247e-29100.00Calmodulin OS=Euphorbia characias PE=2 SV=4[more]
CALM_BRYDI1.247e-29100.00Calmodulin OS=Bryonia dioica PE=2 SV=2[more]
CALM7_ARATH1.247e-29100.00Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIIaR_A10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIIaR_A10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304657 ID=CB304657|Name=CB304657|organism=Citrus sinensis|type=EST|length=581bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGCCAAGAAACCTAAGCTGA
TAGCCTGATACATAAAATAGGATACATATTTCGACCAAAAGAAAAATAAA
CATCGCAAGGGCAGAAATTAATGAAACACATTAAACAGACAACAACATTC
ATAGAACAGCAGAACAACTAAAATAATAAAAACCGAAAAGTTTTGCGAGT
CACAAGACATATTGACGAGGGAGACAACATTCTTCCTACACCATCAGGCC
CATCACCATTAAAAGACCATTGCTTCCTTTAGCCTGACCCTCATGACTAT
CAAATTAAAAATTGTAAAAGAGAAAACTAGGAATCCCTTTATAATTTAGT
CAACCCATTTTATAAGTATTGGGGGGTTGGGGTCATTACTTGGCCATCAT
AACCTTGACAAATTCCTCATAATTTATCTGGCCATCACCATCAACATCAG
CTTCCCTTATCATCTCATCGACTTCTTCATCAGTAAGTTTCTCTCCTAGG
TTTGTCATCACATGGCGCAGCTCAGCAGCTGAGATGAAACCATTCTGATC
CTTGTCGAAAACCCGGAAGGCCTCTTTCAGC
back to top