CB304665

Overview
NameCB304665
Unique NameCB304665
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length531
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12567 contig Csv1_Contig12567:763..1291. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 7.017e-79
Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = -3
Query:   92 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 529
            NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD
Sbjct:  210 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 355          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 1.514e-73
Identity = 135/146 (92.47%), Postives = 141/146 (96.58%), Query Frame = -3
Query:   92 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 529
            NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVK L+SIGMI+ VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNALDG+YVGG+HPELILAAADSAE AD
Sbjct:  206 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPELILAAADSAEIAD 351          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 2.263e-69
Identity = 128/146 (87.67%), Postives = 136/146 (93.15%), Query Frame = -3
Query:   92 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 529
            NWALV+ NH TQSCMDPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALK+LG PNA+DGT VG + PEL+LAAADSAET D
Sbjct:  203 NWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVD 348          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 8.327e-64
Identity = 120/140 (85.71%), Postives = 128/140 (91.43%), Query Frame = -3
Query:  110 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAAD 529
            NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT    +  EL++A  D
Sbjct:  209 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREELMIAYKD 348          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.202e-62
Identity = 121/144 (84.03%), Postives = 130/144 (90.28%), Query Frame = -3
Query:  110 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHP----ELILAAAD 529
            NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT +  V P    E ++A+ D
Sbjct:  206 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGT-IPEVSPALREEFVIASKD 348          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 4.601e-38
Identity = 76/114 (66.67%), Postives = 93/114 (81.58%), Query Frame = -3
Query:  188 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 529
            NW LVSM+HD QSCMDPN + A +V+S+ GHD P GA  VKRL S+G IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK
Sbjct:  200 NWTLVSMHHDDQSCMDPNTINAPLVISTTGHDAPMGAFCVKRLVSMGRIEKLGGMRGLDMNVAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGLKAAEEALK 313          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 1.749e-37
Identity = 75/114 (65.79%), Postives = 92/114 (80.70%), Query Frame = -3
Query:  188 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 529
            NW LVSM+HD QSCMDPN + A +++S+ GHDGP GA  VKRL S+  IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK
Sbjct:  196 NWTLVSMHHDDQSCMDPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALK 309          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 2.525e-36
Identity = 71/114 (62.28%), Postives = 91/114 (79.82%), Query Frame = -3
Query:  188 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 529
            NW LV+++HD  SCMDPN + A V++S+ GHDGPFGA   KRL S+G ++++ GM+ LDMNSAEDAIV+ TREV  G+I+ GME++EIDG  RMGPTFGAM++SG KAA  ALK
Sbjct:  203 NWTLVTLHHDDHSCMDPNTINAPVIISTTGHDGPFGAFCAKRLVSMGSVDKLGGMRGLDMNSAEDAIVKNTREVTKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALK 316          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.253e-35
Identity = 72/128 (56.25%), Postives = 94/128 (73.44%), Query Frame = -3
Query:  146 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVG 529
            NW LVS+NHD QSCMDP+ + A +V S  GHDGPFGA  VKR+ S G+ E +  M+ LDM  AED I   TRE++PG+IV GME++E DG+ RMGPTFGAM++SG++AA +AL+SL +    +G  VG
Sbjct:  208 NWTLVSLNHDHQSCMDPSTITAPLVCSFAGHDGPFGAFCVKRVASAGLSEGLGDMRPLDMERAEDHIANKTREILPGLIVGGMELSEFDGSARMGPTFGAMLLSGKRAAEVALQSLDRVKIEEGEVVG 335          
BLAST of CB304665 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 1.637e-35
Identity = 75/127 (59.06%), Postives = 90/127 (70.87%), Query Frame = -3
Query:  149 NWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYV 529
            NW LVS+NH  QSCMDPN + A +VVS+ GHDGPFGA  VKRL S  ++  +  M+ LDMN AED IV+ TREV PGMIV GME++E DGA RMGPTFG MM SG KAA  AL    +  A++  Y+
Sbjct:  202 NWTLVSLNHGLQSCMDPNTINAHLVVSATGHDGPFGAFCVKRLASAQLVSNLHDMRPLDMNRAEDLIVKGTREVFPGMIVGGMELSEFDGANRMGPTFGGMMFSGIKAAQEALAIFDERKAVNEKYL 328          
The following BLAST results are available for this feature:
BLAST of CB304665 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
THI4_CITSI7.017e-79100.00Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL1.514e-7392.47Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH2.263e-6987.67Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE8.327e-6485.71Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE1.202e-6284.03Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI4_FUSSH4.601e-3866.67Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_FUSOX1.749e-3765.79Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR2.525e-3662.28Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_UROFA1.253e-3556.25Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]
THI2_SCHPO1.637e-3559.06Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIIaR_B07 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIIaR_B07 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304665 ID=CB304665|Name=CB304665|organism=Citrus sinensis|type=EST|length=531bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCAGAGTTTATTTGCATGCAC
ACAGCTGATGAGTGATGATGCCTGTTATTATCAAATTAACCATCAGCAGT
CTCAGCAGAATCAGCTGCAGCTAAGATCAGCTCAGGGTGAACACCTCCCA
CATATGTACCGTCTAATGCATTCGGCTGGCCCAGTGACTTCAACGCCAAA
TGCGCAGCCTTCTGCCCCGATATCATCATTGCTCCAAATGTTGGCCCCAT
TCTAGGAGCACCATCAATCTCGGCAACTTCCATGCCGGTAACTATCATAC
CAGGCACAACCTCCCTGGTCAGCCTCACAATAGCATCTTCTGCAGAGTTC
ATGTCCAGTGCCTTCATTCCAGGCACTTCCTCAATCATTCCGATACTCTT
CAACCTCTTTACTCCAGTGGCCCCAAAAGGCCCATCATGGCCACAAGAGC
TCACAACCACCTTCGCTTCCATTACATTGGGATCCATGCAAGACTGTGTA
TCGTGATTCATTGACACCAACGCCCAGTTGG
back to top