CB304666

Overview
NameCB304666
Unique NameCB304666
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length546
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304666_ssr66 microsatellite CB304666_ssr66:66..77. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2568 contig Csv1_Contig2568:325..871. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304666 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 8.004e-41
Identity = 81/84 (96.43%), Postives = 82/84 (97.62%), Query Frame = -3
Query:  293 PVADGISXXISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKIRAH 544
            PVADGIS  ISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHK+RAH
Sbjct:   14 PVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 97          
BLAST of CB304666 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.469e-18
Identity = 48/90 (53.33%), Postives = 60/90 (66.67%), Query Frame = -3
Query:  296 VADGISXXISRRGYAAAAPLG---TISRTGIMEKNDLRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKIRA 541
            + DG+   ISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID AELREMLLNH++R+
Sbjct:   15 IFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRS 104          
BLAST of CB304666 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.618e-17
Identity = 46/90 (51.11%), Postives = 59/90 (65.56%), Query Frame = -3
Query:  296 VADGISXXISRRGYAAAAPLG---TISRTGIMEKNDLRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKIRA 541
            V D +   ISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID A+LREM+LNH++R+
Sbjct:   15 VFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRS 104          
The following BLAST results are available for this feature:
BLAST of CB304666 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
LEA5_CITSI8.004e-4196.43Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI1.469e-1853.33Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI3.618e-1751.11Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIIaR_B08 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIIaR_B08 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304666 ID=CB304666|Name=CB304666|organism=Citrus sinensis|type=EST|length=546bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTTACAGTCTGGGATCCCAG
ACCGCATAACCCCTCTATATATATATAAAAGTAATTTTGCAATACAGGAA
TTCTTTACTTTTATTGACAAGTTAATAGACAAAATCATGGAAATGCACTA
TTAAAAGTTGTCAATAACAGTTGATATCAATACAACAGCAAAGACTTAAG
AGTGAGTCAAATTGCTACTGTAACAACATCACTTAAAAAGTTAAAGCACC
GCTAACAGCAAAGGATCTGCTGCTATGCGCCACCACTCCCTAGTGTGCCC
TGATTTTGTGGTTCAACAGCATCTCTCGAAGCTCTGCTGGATCAATCTCG
ACCGCCCGATTCTCCGGCCTGTAGTACCCAGTGATGGGATCTGGGGCCCA
GGCAGAAGAGGCCCCAGAATCCTCTCTCACCGCAGGCCTCAAATCATTTT
TCTCCATGATACCAGTCCGAGATATGGTCCCCAAGGGTGCTGCTGCAGCA
TATCCTCTCCTGCTAATGGNNNNCGAGATGCCATCAGCAACAGGAG
back to top