CB304676

Overview
NameCB304676
Unique NameCB304676
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length587
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6837 contig Csv1_Contig6837:375..961. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE_CITUN (V-type proton ATPase subunit E OS=Citrus unshiu GN=VATE PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.965e-48
Identity = 99/111 (89.19%), Postives = 99/111 (89.19%), Query Frame = -1
Query:  255 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLXXXXXXXXXXXPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA 587
            QSLLR KEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYL           PSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA
Sbjct:  120 QSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLPPGPGHHNAHGPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA 230          
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE_CITLI (V-type proton ATPase subunit E OS=Citrus limon GN=VATE PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.965e-48
Identity = 99/111 (89.19%), Postives = 99/111 (89.19%), Query Frame = -1
Query:  255 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLXXXXXXXXXXXPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA 587
            QSLLR KEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYL           PSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA
Sbjct:  120 QSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLPPGPGHHNAHGPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA 230          
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE_GOSHI (V-type proton ATPase subunit E OS=Gossypium hirsutum GN=VATE PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 5.542e-33
Identity = 79/121 (65.29%), Postives = 85/121 (70.25%), Query Frame = -1
Query:  255 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVD----------HHIYLXXXXXXXXXXXPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA 587
            QSL+R KEP VLLRCRK+D HLVESVL+SAKEEYA K+ VHPPEIIVD          HH +              CSGGVV+ASRDGKIV ENTLDARLDV F KKLPEIRK L  QVAA
Sbjct:  120 QSLVRLKEPGVLLRCRKEDLHLVESVLDSAKEEYASKVNVHPPEIIVDDVHLPPGPSHHHGFFHHHAEAHGPF---CSGGVVIASRDGKIVFENTLDARLDVAFNKKLPEIRKWLFGQVAA 237          
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE_SPIOL (V-type proton ATPase subunit E OS=Spinacia oleracea GN=VATE PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.750e-32
Identity = 75/111 (67.57%), Postives = 84/111 (75.68%), Query Frame = -1
Query:  255 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLXXXXXXXXXXXPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA 587
            QSLLR +EP VLLRCR+DD HLVE VL SAKEEYA+K +VH PEIIVD  I+L             CSGGVV+ASRDGKIV ENTLDARL+V FRKKLP+IRKQL +  AA
Sbjct:  120 QSLLRLREPGVLLRCREDDVHLVEHVLNSAKEEYAEKAEVHTPEIIVD-SIHLPAGPSHHKEHGLHCSGGVVLASRDGKIVFENTLDARLEVAFRKKLPQIRKQLFAVAAA 229          
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE3_ARATH (V-type proton ATPase subunit E3 OS=Arabidopsis thaliana GN=VHA-E3 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 8.002e-32
Identity = 70/111 (63.06%), Postives = 82/111 (73.87%), Query Frame = -1
Query:  255 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLXXXXXXXXXXXPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA 587
            Q LLR KEPAVLLRCR++D  +VES+L+ A EEY +K +VH PEIIVD  I+L            SC+GGVV+ASRDGKIVCENTLDARL+V FR KLPEIRK L  +V A
Sbjct:  126 QCLLRLKEPAVLLRCREEDLDIVESMLDDASEEYCKKAKVHAPEIIVDKDIFLPPAPSDDDPHALSCAGGVVLASRDGKIVCENTLDARLEVAFRNKLPEIRKSLFGKVGA 236          
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE1_ARATH (V-type proton ATPase subunit E1 OS=Arabidopsis thaliana GN=VHA-E1 PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 3.041e-31
Identity = 71/111 (63.96%), Postives = 80/111 (72.07%), Query Frame = -1
Query:  255 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLXXXXXXXXXXXPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA 587
            Q LLR KEP+VLLRCR++D  LVE+VL+ AKEEYA K +VH PE+ VD  I+L             CSGGVV+ASRDGKIVCENTLDARLDV FR KLP IRK L  QV A
Sbjct:  120 QCLLRLKEPSVLLRCREEDLGLVEAVLDDAKEEYAGKAKVHAPEVAVDTKIFLPPPPKSNDPHGLHCSGGVVLASRDGKIVCENTLDARLDVAFRMKLPVIRKSLFGQVTA 230          
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE_MESCR (V-type proton ATPase subunit E OS=Mesembryanthemum crystallinum GN=VATE PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.082e-28
Identity = 69/105 (65.71%), Postives = 78/105 (74.29%), Query Frame = -1
Query:  273 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLXXXXXXXXXXXPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQL 587
            QSLLR KEPAVLLRCR++D H V  VL SA+EEY +K  V  PE+IVD  I+L            SCSGGVV+ASRDGKIV ENTLDARL+V FRKKLP+IRKQL
Sbjct:  120 QSLLRLKEPAVLLRCREEDKHHVHRVLHSAREEYGEKACVSHPEVIVDD-IHLPPAPTSYDSHELSCSGGVVMASRDGKIVFENTLDARLEVAFRKKLPQIRKQL 223          
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE2_ARATH (V-type proton ATPase subunit E2 OS=Arabidopsis thaliana GN=VHA-E2 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.012e-26
Identity = 62/108 (57.41%), Postives = 79/108 (73.15%), Query Frame = -1
Query:  270 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLXXXXXXXXXXXPS--CSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLV 587
            +SLLR KEP+VLLRCR+ D  +VESV+E AK +YA+K +V  P+I +D  ++L               CSGGVV+AS+DGKIVCENTLDARLDV FR+KLP+IR +LV
Sbjct:  120 ESLLRLKEPSVLLRCREMDKKVVESVIEDAKRQYAEKAKVGSPKITIDEKVFLPPPPNPKLPDSHDPHCSGGVVLASQDGKIVCENTLDARLDVAFRQKLPQIRTRLV 227          
BLAST of CB304676 vs. ExPASy Swiss-Prot
Match: VATE2_BOVIN (V-type proton ATPase subunit E 2 OS=Bos taurus GN=ATP6V1E2 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.495e-11
Identity = 41/105 (39.05%), Postives = 60/105 (57.14%), Query Frame = -1
Query:  273 QSLLRPKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLXXXXXXXXXXXPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQL 587
            Q LLR  EP V++RCR  DH LVE+ ++ A  +Y   +     E+ VD  + L              +GGV V S D +I+  NTL++RLD++ ++K+PEIRK L
Sbjct:  122 QGLLRLLEPVVIVRCRPQDHFLVEAAVQRAIPQYTA-VSHRCVEVQVDKEVQLAT----------DTTGGVEVYSSDQRIMVSNTLESRLDLLSQQKMPEIRKAL 215          
The following BLAST results are available for this feature:
BLAST of CB304676 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
VATE_CITUN7.965e-4889.19V-type proton ATPase subunit E OS=Citrus unshiu GN... [more]
VATE_CITLI7.965e-4889.19V-type proton ATPase subunit E OS=Citrus limon GN=... [more]
VATE_GOSHI5.542e-3365.29V-type proton ATPase subunit E OS=Gossypium hirsut... [more]
VATE_SPIOL2.750e-3267.57V-type proton ATPase subunit E OS=Spinacia olerace... [more]
VATE3_ARATH8.002e-3263.06V-type proton ATPase subunit E3 OS=Arabidopsis tha... [more]
VATE1_ARATH3.041e-3163.96V-type proton ATPase subunit E1 OS=Arabidopsis tha... [more]
VATE_MESCR1.082e-2865.71V-type proton ATPase subunit E OS=Mesembryanthemum... [more]
VATE2_ARATH1.012e-2657.41V-type proton ATPase subunit E2 OS=Arabidopsis tha... [more]
VATE2_BOVIN3.495e-1139.05V-type proton ATPase subunit E 2 OS=Bos taurus GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIIaR_C10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIIaR_C10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304676 ID=CB304676|Name=CB304676|organism=Citrus sinensis|type=EST|length=587bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTGCAAAATATTTATTATTAT
ATTAGCCGGCCACACCCCAAAAGATTTGAGCACCAAATCCAAGAACAGAT
TCACTGATTTTCACAAATAAAGATATTCTGCAAACATTATAATTTAAAAT
ATGCAAACAAACAGGAAATAATAAATTTTATGGTCAATAACTAAACTTAA
AAACTTCGGACATGAATAATCAGAGGGTGACAAACAATTCAAATTAACTC
ATCATGCAGCAACCTGACTGACGAGCTGCTTCCGGATCTCAGGAAGTTTT
TTACGGAACACAACATCCAACCGTGCATCAAGGGTATTCTCACATACTAT
CTTCCCATCTCGAGAAGCCACCACGACACCTCCTGAGCAGGATGGACCAT
GGGCATTATGATGGCCAGGGCCAGGCGGAAGATAGATGTGATGATCCACA
ATTATCTCTGGTGGGTGAACCTGCAATTTCTGTGCATATTCCTCTTTTGC
TGACTCCAAAACAGACTCCACCAAATGATGGTCATCTTTGCGGCATCTCA
GTAACACAGCTGGCTCTTTCGGCCTGAGCAAACTCTG
back to top