CB304679

Overview
NameCB304679
Unique NameCB304679
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length608
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304679_ssr174 microsatellite CB304679_ssr174:174..185. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2668 contig Csv1_Contig2668:196..802. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.024e-32
Identity = 64/97 (65.98%), Postives = 77/97 (79.38%), Query Frame = -3
Query:  238 PXTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 528
            P T A++CGQV+ SLAPCI++L  GG  PP  CC+GV+SLN AA+TTPDRQAAC CLK AY S  G+NA  AA  P +CGVSIPYKISP+TDCS+V+
Sbjct:   21 PYTEALSCGQVSSSLAPCISYLTKGGAVPPA-CCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.082e-32
Identity = 64/92 (69.57%), Postives = 74/92 (80.43%), Query Frame = -3
Query:  238 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 513
            ITCGQV+ SLAPCI +LR GG   P  CCNGVRSLN AA+TT DRQAACNCLK A+ S  G+N N+AAGLP +CGVS+PYKISP+TDC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGG-VVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.132e-31
Identity = 61/97 (62.89%), Postives = 76/97 (78.35%), Query Frame = -3
Query:  238 PXTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 528
            P   AITCGQV+ +LAPCI ++R GG  PP  CCNG+R++N  ARTTPDRQAACNCLKQ   S PG+N N AA LP +CGV+IPY+ISP+T+C+ V+
Sbjct:   22 PIAQAITCGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.294e-31
Identity = 59/97 (60.82%), Postives = 76/97 (78.35%), Query Frame = -3
Query:  238 PXTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 528
            P   A+TCGQV+ +LAPCIA++R GG  PP  CCNG+R++N  A+TT DRQ ACNCLKQ   S PG+NAN AA LP +CGV++PYKISP+T+C+ V+
Sbjct:   22 PIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 4.757e-30
Identity = 59/94 (62.77%), Postives = 74/94 (78.72%), Query Frame = -3
Query:  238 NAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 519
            +AITCGQVT SLAPCI ++R+GG  PP  CCNG+R++NG ARTT DRQ ACNCLK    S  G+N N AAGLP +CGV++PYKIS +T+C+ V+
Sbjct:   23 HAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUPE (Non-specific lipid-transfer protein 1 OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.060e-29
Identity = 59/92 (64.13%), Postives = 72/92 (78.26%), Query Frame = -3
Query:  238 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 513
            ITCGQV+ +LAPCI ++R GG  PP  CCNG+R++N  ARTTPDRQAACNCLKQ   S PG+N N AA LP +CGV IPYKIS +T+C+ V+
Sbjct:    1 ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 2.610e-28
Identity = 57/92 (61.96%), Postives = 71/92 (77.17%), Query Frame = -3
Query:  238 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 513
            ITCGQV+ SLAPCI ++R GG  PP  CCNG+R++N  ARTTPDR+ ACNCLKQ   S  G+N N AA LP +CGV+IPYKIS +T+C+ V+
Sbjct:    1 ITCGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP_DAUCA (Non-specific lipid-transfer protein OS=Daucus carota GN=EP2 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 5.815e-28
Identity = 57/92 (61.96%), Postives = 69/92 (75.00%), Query Frame = -3
Query:  241 ITCGQVTGSLAPCIAFLRTGGRFPPP-PCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRV 513
            +TCGQVTG+LAPC+ +LR+    P P  CCN VR LN AARTT D++ AC CLKQ   +  G+N N AAGLP +CGV+IPYKISP TDC+RV
Sbjct:   28 LTCGQVTGALAPCLGYLRSQVNVPVPLTCCNVVRGLNNAARTTLDKRTACGCLKQTANAVTGLNLNAAAGLPARCGVNIPYKISPTTDCNRV 119          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDO (Non-specific lipid-transfer protein 1 OS=Prunus domestica PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 9.918e-28
Identity = 55/92 (59.78%), Postives = 72/92 (78.26%), Query Frame = -3
Query:  238 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 513
            ITCGQV+ +LAPCI +++ GG  PP  CCNG+R++N  ARTT DR+AACNCLKQ   S PG+N N AA LP +CGV++PYKIS +T+C+ V+
Sbjct:    1 ITCGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK 91          
BLAST of CB304679 vs. ExPASy Swiss-Prot
Match: NLTP_MAIZE (Non-specific lipid-transfer protein OS=Zea mays PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.210e-27
Identity = 57/92 (61.96%), Postives = 68/92 (73.91%), Query Frame = -3
Query:  241 AITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSTPGINANVAAGLPRQCGVSIPYKISPNTDCSRV 516
            AI+CGQV  ++APCI++ R  G  P   CC+GVRSLN AARTT DR+AACNCLK A     G+NA  AA +P +CGVSIPY IS +TDCSRV
Sbjct:   28 AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119          
The following BLAST results are available for this feature:
BLAST of CB304679 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
NLTP_HELAN1.024e-3265.98Non-specific lipid-transfer protein OS=Helianthus ... [more]
LTP1_MORNI5.082e-3269.57Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP1_PRUDU1.132e-3162.89Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_PRUAV3.294e-3160.82Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP_MALDO4.757e-3062.77Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP1_PRUPE1.060e-2964.13Non-specific lipid-transfer protein 1 OS=Prunus pe... [more]
NLTP1_PRUAR2.610e-2861.96Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]
NLTP_DAUCA5.815e-2861.96Non-specific lipid-transfer protein OS=Daucus caro... [more]
NLTP1_PRUDO9.918e-2859.78Non-specific lipid-transfer protein 1 OS=Prunus do... [more]
NLTP_MAIZE2.210e-2761.96Non-specific lipid-transfer protein OS=Zea mays PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIIaR_D03 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIIaR_D03 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304679 ID=CB304679|Name=CB304679|organism=Citrus sinensis|type=EST|length=608bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGAATAACTAGAATTAATCAC
TCAAAACACAGATCACGTTTACATATTTAATATGATATTAAAAGCAAAGA
TACAAACATGACATGAGAGTGAGACTCACACAAGTGGAGACTCGTTCGGA
CAAAGAAATTAACATATATATTCTTTATTTATTTATTCTTCTCAGTCAAT
CATACTTGGAAAGTCACAGAGCTCAAACTCAACTTCACCTGACCCTAGAG
CAGTCAGTGTTGGGGCTGATCTTGTAAGGAATGCTGACTCCACATTGACG
AGGAAGGCCAGCGGCAACATTAGCGTTGATGCCGGGGGTTGATCGGTAAG
CTTGCTTCAAGCAGTTGCATGCAGCTTGGCGGTCAGGGGTGGTTCTGGCG
GCGCCGTTGAGAGACCTGACGCCGTTACAGCATGGGGGTGGAGGAAAACG
CCCTCCAGTTCTCAAGAAAGCGATGCATGGAGCCAAGGAGCCCGTCACCT
GCCCACATGTTATGGCATTAGTNNNTGGGGCAGTCACCAGAGTGCACAAA
AGCAAAGCACAAACAAGCTTAAGAGCAGCCATGAGGATTTTTCAGGGAGG
CTTTTGCT
back to top