CB304731

Overview
NameCB304731
Unique NameCB304731
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length611
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304731 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 1.071e-29
Identity = 67/101 (66.34%), Postives = 76/101 (75.25%), Query Frame = -1
Query:  279 TRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDSFFHALECEPPLQIGYQPADPISVVTAGPSLNNYMQGWLP 581
            TRTQ MLD L +LQ KE  L+EAN+TLKQRLMEG  +N LQ   +A+D GYG +  Q QGD FFH LECEP LQIGYQ  DPI+V  AGPS+NNYM GWLP
Sbjct:  143 TRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQ-NDPITVGGAGPSVNNYMAGWLP 241          
BLAST of CB304731 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 6.944e-29
Identity = 67/104 (64.42%), Postives = 75/104 (72.12%), Query Frame = -1
Query:  279 TRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLK-PAQPQGDSFFHA--LECEPPLQIGYQPADPISVVTAGPSLNNYMQGWLP 581
            TRTQ+MLD L +LQ KE LL EAN+ L+QR MEGYQ+N+LQLN SAED GYG        GD  F    +ECEP LQIGY   DP SVVTAGPS+NNYM GWLP
Sbjct:  145 TRTQFMLDQLGDLQRKEHLLCEANRALRQR-MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGYHQGDPGSVVTAGPSMNNYMGGWLP 247          
BLAST of CB304731 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.090e-21
Identity = 57/103 (55.34%), Postives = 70/103 (67.96%), Query Frame = -1
Query:  279 RTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCG-YGLKPAQPQ--GDSFFHALECEPPLQIGYQPADPISVVTAGPSLNNYMQGWLP 578
            RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ E+   YG    Q Q    +FF  LECEP LQIGYQ       + AGPS+NNYM GWLP
Sbjct:  146 RTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQM-PLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQ--DGMGAGPSVNNYMLGWLP 245          
BLAST of CB304731 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.090e-21
Identity = 58/105 (55.24%), Postives = 70/105 (66.67%), Query Frame = -1
Query:  279 RTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAED--CGYGLKPAQPQGDS---FFHALECEPPLQIGYQPADPISVVTAGPSLNNYMQGWLP 578
            RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ ED    YG    Q Q +S   FF  LECEP LQ+GYQ       + AGPS NNYM GWLP
Sbjct:  146 RTQFMLDQLNDLQSKERMLNETNKTLRLRLADGYQM-PLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEPILQMGYQGQQDHG-MEAGPSENNYMLGWLP 248          
BLAST of CB304731 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.187e-20
Identity = 55/103 (53.40%), Postives = 70/103 (67.96%), Query Frame = -1
Query:  282 TRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPS-AEDCGYGLKPAQPQGDSFFHALECEPPLQIGYQPADPISVVTAGPSLNNYM-QGWL 581
            TRTQ+MLD L +LQ +EQ+L EANKTLK+R  E  Q N  Q+ +PS     GYG +PAQ  G++F+H LECEP LQIGY     ++  TA  ++NNYM  GWL
Sbjct:  141 TRTQFMLDQLADLQRREQMLCEANKTLKRRFEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYHPLECEPTLQIGYHSDITMATATAS-TVNNYMPPGWL 242          
BLAST of CB304731 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSJ (MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 5.906e-12
Identity = 45/108 (41.67%), Postives = 63/108 (58.33%), Query Frame = -1
Query:  279 TRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDSFFHALEC--EPPLQIGYQPADPISVVTAGPSLNNYMQGWLP 581
            TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   EP LQIGY PA+    + +   +N YM  WLP
Sbjct:  144 TRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY-PAEHHEAMNSA-CMNTYMPPWLP 249          
BLAST of CB304731 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSI (MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 5.906e-12
Identity = 45/108 (41.67%), Postives = 63/108 (58.33%), Query Frame = -1
Query:  279 TRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDSFFHALEC--EPPLQIGYQPADPISVVTAGPSLNNYMQGWLP 581
            TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   EP LQIGY PA+    + +   +N YM  WLP
Sbjct:  144 TRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY-PAEHHEAMNSA-CMNTYMPPWLP 249          
BLAST of CB304731 vs. ExPASy Swiss-Prot
Match: MADS8_ORYSJ (MADS-box transcription factor 8 OS=Oryza sativa subsp. japonica GN=MADS8 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.530e-11
Identity = 47/111 (42.34%), Postives = 62/111 (55.86%), Query Frame = -1
Query:  279 TRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGY------GLKPAQPQ-GDSFFHALE--CEPPLQIGYQPAD-PISVVTAGPSLNNYMQGWLP 581
            TRTQ+MLD LT+LQ +EQ+L EANK L+++L E  Q++       A   GY       ++   P  G+ FFH+LE   EP LQIG+ P     S VTA      +M  WLP
Sbjct:  144 TRTQHMLDQLTDLQRREQMLCEANKCLRRKLEESNQLHGQVWEHGATLLGYERQSPHAVQQVPPHGGNGFFHSLEAAAEPTLQIGFTPEQMNNSCVTA------FMPTWLP 248          
The following BLAST results are available for this feature:
BLAST of CB304731 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
AGL9_PETHY1.071e-2966.34Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
MTF1_PEA6.944e-2964.42MADS-box transcription factor 1 OS=Pisum sativum G... [more]
SEP3_ARATH9.090e-2155.34Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]
AGL9_SINAL9.090e-2155.24Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL9_ARADE1.187e-2053.40Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
MADS7_ORYSJ5.906e-1241.67MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS7_ORYSI5.906e-1241.67MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS8_ORYSJ6.530e-1142.34MADS-box transcription factor 8 OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_A10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_A10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304731 ID=CB304731; Name=CB304731; organism=Citrus sinensis; type=EST; length=611bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCATTCTCAAACAAGGCTTTGT
TAAATAAAGATAAGCGCGGGGATTGAAAATACACGCACACACAACATAGC
TATATATCGTCATCAGTTTCCCTAAAGGGCAGGATCACTGTAGAGTTATT
ATAATAAATCCTTATGATTGCGTGTTCCTAGTCACTGAATAGGGTTGCTT
ACAAAGGGATACAAAGTTGCTGATTCTTATGGATCAACTACAATACATTG
ACTGGTAATGCCCGCCGCTCTCTTAGCATGGTAGCCATCCTTGCATGTAA
TTATTCAAACTCGGGCCTGCTGTGACAACCGATATTGGGTCCGCAGGCTG
GTATCCAATTTGCAATGGGGGTTCACATTCCAAGGCGTGAAAAAAGCTAT
CGCCCTGAGGTTGAGCTGGTTTAAGCCCATAACCACAATCTTCTGCACTA
GGATTCAATTGAAGTGTGTTCACTTGGTATCCCTCCATCAACCTTTGTTT
GAGGGTCTTATTTGCTTCGCTCAGCAACTGTTCCTTATGTTGCAGTTCAG
TAAGGGTATCCAGCATGTACTGAGTTCTTGTGATCTGATCTGCTTCATGA
CATATCAAGCT
back to top