CB304780

Overview
NameCB304780
Unique NameCB304780
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length488
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304780_ssr139 microsatellite CB304780_ssr139:139..148. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9479 contig Csv1_Contig9479:1478..1965. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304780 vs. ExPASy Swiss-Prot
Match: CYSZ_CUCMA (Citrate synthase, glyoxysomal OS=Cucurbita maxima PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.502e-20
Identity = 44/58 (75.86%), Postives = 52/58 (89.66%), Query Frame = -1
Query:  315 RESLDDPDTKIMRPQQVYTGVWMRHYMPLKERMIEKNADRLGQVSVSNATRRRLAGSG 488
            RESLDDPDTKI+RPQQVYTG W+RHY+P  ER++   ADRLGQVSVSNA++RRL+GSG
Sbjct:  458 RESLDDPDTKIIRPQQVYTGEWLRHYIPPNERLVPAKADRLGQVSVSNASKRRLSGSG 515          
BLAST of CB304780 vs. ExPASy Swiss-Prot
Match: CISY3_ARATH (Citrate synthase 3, peroxisomal OS=Arabidopsis thaliana GN=CSY3 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 5.056e-19
Identity = 43/60 (71.67%), Postives = 53/60 (88.33%), Query Frame = -1
Query:  318 RESLDDPDTKIMRPQQVYTGVWMRHYMPLKERMI---EKNADRLGQVSVSNATRRRLAGS 488
            +ESLDDPDTKIMRPQQVYTGVW+RHY P++ER++    K +D+LGQV+ SNA+RRRLAGS
Sbjct:  448 KESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVATSNASRRRLAGS 507          
BLAST of CB304780 vs. ExPASy Swiss-Prot
Match: CISY2_ARATH (Citrate synthase 2, peroxisomal OS=Arabidopsis thaliana GN=CSY2 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.509e-18
Identity = 42/59 (71.19%), Postives = 51/59 (86.44%), Query Frame = -1
Query:  318 RESLDDPDTKIMRPQQVYTGVWMRHYMPLKERMI--EKNADRLGQVSVSNATRRRLAGS 488
            RESLDDPDT+IMRPQQ YTGVWMRHY P++ER +  + + D+ GQVS+SNA+RRRLAGS
Sbjct:  453 RESLDDPDTRIMRPQQAYTGVWMRHYEPVRERTLSSDSDKDKFGQVSISNASRRRLAGS 511          
The following BLAST results are available for this feature:
BLAST of CB304780 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CYSZ_CUCMA3.502e-2075.86Citrate synthase, glyoxysomal OS=Cucurbita maxima ... [more]
CISY3_ARATH5.056e-1971.67Citrate synthase 3, peroxisomal OS=Arabidopsis tha... [more]
CISY2_ARATH2.509e-1871.19Citrate synthase 2, peroxisomal OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_G09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_G09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304780 ID=CB304780|Name=CB304780|organism=Citrus sinensis|type=EST|length=488bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTGTAACAATACCACGCAGGGAAA
GAAATATCTACTACATGATCGAGTAAGAGCAGCTCTGGAAATTCCAAATA
TAGAATCACACGACAGTTTCCCCTAATACACAGTGTGCGTGTGTGTGTTT
ATGTTACCAGTACAAGGAACCAAAAAACATATGAACCTGCTACTTCTGTA
GAAGATATTCAAACAGAAAACCAGAGGCCTGGAATTATTATTTTTCTTTA
TAATATTCATGGCATTTATTTTTCTTCTCTGAATATTTATTCATGAAGCC
AAAAACATTTAATTCCCTGATCCAGCGAGTCTTCGTCTTGTGGCATTTGA
AACAGACACCTGTCCAAGCCTGTCTGCATTCTTCTCTATCATCCGCTCTT
TGAGTGGCATATAATGTCGCATCCATACACCAGTATAAACCTGTTGGGGT
CTCATTATCTTTGTGTCAGGATCATCCAAGGACTCTCG
back to top