CB304781

Overview
NameCB304781
Unique NameCB304781
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length551
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304781_ssr157 microsatellite CB304781_ssr157:157..168. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13803 contig Csv1_Contig13803:83..633. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.316e-33
Identity = 66/110 (60.00%), Postives = 83/110 (75.45%), Query Frame = -2
Query:  221 LVCALLLCILVTAPVTNAITCGQVTASLAPRIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 550
            ++CA + C++V AP T A++CGQV++SLAP I +L  GG  PP  CCSGV+SLN AA+TTPDRQAAC CLK AY +  G+    AA  P +CGV IPYKISPSTDCS+V+
Sbjct:    8 VLCAGVTCMVVGAPYTEALSCGQVSSSLAPCISYLTKGGAVPPA-CCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.407e-32
Identity = 62/110 (56.36%), Postives = 84/110 (76.36%), Query Frame = -2
Query:  221 LVCALLLCILVTAPVTNAITCGQVTASLAPRIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 550
            L   + LC++V+ P+  AITCGQV+++LAP IP++R GG  PP  CC+G+R++N  ARTTPDRQAACNCLK+   +  G+ PN AA LP +CGV IPY+ISPST+C+ V+
Sbjct:    9 LALVVALCMVVSVPIAQAITCGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 7.721e-31
Identity = 61/107 (57.01%), Postives = 81/107 (75.70%), Query Frame = -2
Query:  221 ALLLCILVTAPVTNAITCGQVTASLAPRIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 541
            AL++ + +   V +AITCGQVT+SLAP I ++R+GG  PP  CC+G+R++NG ARTT DRQ ACNCLK   G+  G+ PN AAGLP +CGV +PYKIS ST+C+ V+
Sbjct:   10 ALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 8.536e-30
Identity = 64/110 (58.18%), Postives = 78/110 (70.91%), Query Frame = -2
Query:  221 LVCALLLCILVTAPVTNAITCGQVTASLAPRIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 550
            + C ++LC++V AP   AITCGQVT++LAP + +LR  G  P   CC GV++L  +ARTT DRQ AC CLK A G   GI    AAGLPS CGV IPYKISPSTDCS+V+
Sbjct:    7 IACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTG--PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ 114          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLLC (Non-specific lipid-transfer protein 1 OS=Solanum lycopersicum GN=TSW12 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.902e-29
Identity = 63/110 (57.27%), Postives = 79/110 (71.82%), Query Frame = -2
Query:  221 LVCALLLCILVTAPVTNAITCGQVTASLAPRIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 550
            + C +LLC++V AP   A+TCGQVTA LAP +P+L+  GR P   CC GV++L G+A+TT DR+ AC CLK A    +GI  N AAG+PS C V IPYKISPSTDCS V+
Sbjct:    7 IACFVLLCMVVVAPHAEALTCGQVTAGLAPCLPYLQ--GRGPLGGCCGGVKNLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ 114          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLPN (Non-specific lipid-transfer protein 1 OS=Solanum pennellii GN=LTP1 PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.484e-29
Identity = 63/110 (57.27%), Postives = 78/110 (70.91%), Query Frame = -2
Query:  221 LVCALLLCILVTAPVTNAITCGQVTASLAPRIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 550
            + C +LLC++V AP   A+TCGQVTA LAP +P+L+  GR P   CC GV+ L G+A+TT DR+ AC CLK A    +GI  N AAG+PS C V IPYKISPSTDCS V+
Sbjct:    7 IACFVLLCMVVVAPHAEALTCGQVTAGLAPCLPYLQ--GRGPLGGCCGGVKGLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ 114          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.236e-29
Identity = 56/110 (50.91%), Postives = 80/110 (72.73%), Query Frame = -2
Query:  221 LVCALLLCILVTAPVTNAITCGQVTASLAPRIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 550
            L   + LC++V+ P+  A+TCGQV+++LAP I ++R GG  PP  CC+G+R++N  A+TT DRQ ACNCLK+   +  G+  N AA LP +CGV +PYKISPST+C+ V+
Sbjct:    9 LALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.533e-29
Identity = 60/92 (65.22%), Postives = 73/92 (79.35%), Query Frame = -2
Query:  221 ITCGQVTASLAPRIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 496
            ITCGQV++SLAP I +LR GG   P  CC+GVRSLN AA+TT DRQAACNCLK A+ + +G+  N+AAGLP +CGV +PYKISPSTDC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGG-VVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP2_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.610e-28
Identity = 63/112 (56.25%), Postives = 81/112 (72.32%), Query Frame = -2
Query:  221 LVCALLLCILVTAPVTN-AITCGQVTASLAPRIPFLR-TGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 550
            L C ++LC++V AP+   A+T GQVT SLAP I +LR +G    PP CC+G++SLN AA+TTP RQAAC C+K A     GI   +A+GLP +CGV IPYKISPSTDC+ V+
Sbjct:    9 LACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 120          
BLAST of CB304781 vs. ExPASy Swiss-Prot
Match: NLTP1_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.610e-28
Identity = 63/112 (56.25%), Postives = 81/112 (72.32%), Query Frame = -2
Query:  221 LVCALLLCILVTAPVTN-AITCGQVTASLAPRIPFLR-TGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTNRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 550
            L C ++LC++V AP+   A+T GQVT SLAP I +LR +G    PP CC+G++SLN AA+TTP RQAAC C+K A     GI   +A+GLP +CGV IPYKISPSTDC+ V+
Sbjct:    5 LACVVVLCMVVGAPLAQGAVTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSAAQTTPVRQAACRCIKSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 116          
The following BLAST results are available for this feature:
BLAST of CB304781 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP_HELAN6.316e-3360.00Non-specific lipid-transfer protein OS=Helianthus ... [more]
NLTP1_PRUDU1.407e-3256.36Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_MALDO7.721e-3157.01Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP1_TOBAC8.536e-3058.18Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]
NLTP1_SOLLC1.902e-2957.27Non-specific lipid-transfer protein 1 OS=Solanum l... [more]
NLTP1_SOLPN2.484e-2957.27Non-specific lipid-transfer protein 1 OS=Solanum p... [more]
NLTP_PRUAV4.236e-2950.91Non-specific lipid-transfer protein OS=Prunus aviu... [more]
LTP1_MORNI5.533e-2965.22Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP2_GOSHI1.610e-2856.25Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP1_GOSHI1.610e-2856.25Non-specific lipid-transfer protein OS=Gossypium h... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_G10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_G10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304781 ID=CB304781|Name=CB304781|organism=Citrus sinensis|type=EST|length=551bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGACTCAAAACACAGATCGCG
TTTACATATTTAATATGACATAAAAAGCAAATATACAAACATGACATGAG
AGTGAAACTCATACAAGTGGAGACTCGTTCGGACAAAGAAATTAACATAG
ATATTCTTTATTTATTTATTCTTCTCAGTCAATCATACTTGGAAAGTCAC
AGAGCTCAAACTCAACTTCACCTGACCCTAGAGCAGTCGGTGCTGGGGCT
GATCTTGTAAGGAATTCTGACTCCACATTGACTAGGAAGGCCAGCGGCAA
CATTAGGTTTGATGCCGCGGTTTGTTCCGTAAGCTCGTTTCAAGCAGTTG
CATGCAGCTTGGCGGTCAGGGGTGGTTCTGGCGGCGCCGTTGAGAGACCT
GACGCCGCTACAGCATGGCGGTGGAGGAAAACGCCCTCCAGTTCTCAAGA
AAGGGATGCGTGGAGCCAAGGAGGCTGTCACCTGCCCGCATGTTATGGCA
TTAGTCACCGGGGCAGTCACCAGAATGCACAAAAGCAAAGCACAAACAAG
C
back to top