CB304784

Overview
NameCB304784
Unique NameCB304784
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length610
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRP_SOYBN (Glutathione reductase, chloroplastic OS=Glycine max GN=GR PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 5.948e-65
Identity = 120/143 (83.92%), Postives = 133/143 (93.01%), Query Frame = -3
Query:  180 TKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKIRKSPPSEGMTGPEVKAAAGV 608
            TKPDY AVPSAVFSQPPIGQVGL+EEQA+Q+YGDID+FTANFRPLKATLSGLPDR+FMKLV+CAKTN+VLGL MCGEDAPEIVQGFAVA+KA LTKADFDA VG+HP+AAEEFV +RTPTRKIRKS  SEG +G + KAAAGV
Sbjct:  402 TKPDYRAVPSAVFSQPPIGQVGLTEEQAVQQYGDIDIFTANFRPLKATLSGLPDRVFMKLVVCAKTNEVLGLHMCGEDAPEIVQGFAVALKARLTKADFDATVGIHPSAAEEFVTMRTPTRKIRKSESSEGKSGSQAKAAAGV 544          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRP_TOBAC (Glutathione reductase, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GOR PE=1 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.791e-61
Identity = 113/143 (79.02%), Postives = 131/143 (91.61%), Query Frame = -3
Query:  180 TKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKIRKSPPSEGMTGPEVKAAAGV 608
            TKPDY  VP+AVFSQPPIGQVGL EEQAI+E+GD+DV+TANFRPLKAT+SGLPDR+FMKL++CAKT+KVLGL MCG+DAPEIVQGFA+AVKAGLTKADFDA VG+HPT+AEEFV +RTPTRK+R S PSEG    ++KAAAGV
Sbjct:  416 TKPDYRNVPAAVFSQPPIGQVGLMEEQAIKEFGDVDVYTANFRPLKATISGLPDRVFMKLIVCAKTSKVLGLHMCGDDAPEIVQGFAIAVKAGLTKADFDATVGIHPTSAEEFVTMRTPTRKVRSS-PSEGKAEHDIKAAAGV 557          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRP_ARATH (Glutathione reductase, chloroplastic OS=Arabidopsis thaliana GN=EMB2360 PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 2.586e-60
Identity = 112/143 (78.32%), Postives = 125/143 (87.41%), Query Frame = -3
Query:  180 TKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKIRKSPPSEGMTGPEVKAAAGV 608
            TKPDY AVP AVFSQPPIG VGL+EEQAI++YGD+DV+T+NFRPLKATLSGLPDR+FMKL++CA TNKVLG+ MCGED+PEI+QGF VAVKAGLTKADFDA VGVHPTAAEEFV +R PTRK RK   SEG   PE K AAGV
Sbjct:  424 TKPDYRAVPCAVFSQPPIGTVGLTEEQAIEQYGDVDVYTSNFRPLKATLSGLPDRVFMKLIVCANTNKVLGVHMCGEDSPEIIQGFGVAVKAGLTKADFDATVGVHPTAAEEFVTMRAPTRKFRKD-SSEGKASPEAKTAAGV 565          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRP_PEA (Glutathione reductase, chloroplastic/mitochondrial OS=Pisum sativum GN=GR PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 4.129e-58
Identity = 107/142 (75.35%), Postives = 124/142 (87.32%), Query Frame = -3
Query:  183 TKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKIRKSPPSEGMTGPEVKAAAG 608
            TKPDY A+PSAVFSQPPIG VGL+EEQA ++YGDIDVFTANFRP+KATLSGLPDR+FMKL++ A+TN VLGL MCGEDA EI QGFAV +KAGLTKADFDA VG+HPTAAEEFV +RTPTRK+RK+  S+G +  + KA AG
Sbjct:  410 TKPDYRAIPSAVFSQPPIGGVGLTEEQAAEQYGDIDVFTANFRPMKATLSGLPDRVFMKLIVSAETNVVLGLHMCGEDAAEIAQGFAVGIKAGLTKADFDATVGIHPTAAEEFVTMRTPTRKVRKNQASQGKSDSKAKAVAG 551          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRC_PEA (Glutathione reductase, cytosolic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.292e-35
Identity = 70/124 (56.45%), Postives = 97/124 (78.23%), Query Frame = -3
Query:  240 TKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEY-GDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKI 608
            +KPDY+ +P AVF  PP+  VGLSEEQA+++  GD+ +FT+ F P+K T+SG  ++  MKLV+ A+T+KVLG  MCG DAPEIVQG A+A+K G TKA FD+ VG+HP++AEEFV +R+ TR++
Sbjct:  365 SKPDYNDIPYAVFCIPPLSVVGLSEEQAVEQTKGDVLIFTSTFNPMKNTISGRQEKTVMKLVVDAQTDKVLGASMCGPDAPEIVQGIAIAIKCGATKAQFDSTVGIHPSSAEEFVTMRSETRRV 488          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRP_SPIOL (Glutathione reductase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.760e-35
Identity = 73/124 (58.87%), Postives = 97/124 (78.23%), Query Frame = -3
Query:  240 TKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEY-GDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKI 608
            +KPDYS +  AVFS PP+  VGLSEEQAI++  GDI VFT++F P+K T+SG  ++  MKLV+ A+T+KVLG  MCG DA EI+QG A+A+K G TKA FD+ VG+HP+AAEEFV +R P+R++
Sbjct:  356 SKPDYSNIACAVFSIPPLAVVGLSEEQAIEQASGDILVFTSSFNPMKNTISGRQEKTIMKLVVDAETDKVLGASMCGPDAAEIMQGIAIALKFGATKAQFDSTVGIHPSAAEEFVTMREPSRRV 479          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRC_ORYSJ (Glutathione reductase, cytosolic OS=Oryza sativa subsp. japonica GN=GRC2 PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.094e-34
Identity = 75/134 (55.97%), Postives = 101/134 (75.37%), Query Frame = -3
Query:  210 TKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEY-GDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKIRKSPPSEGMT 608
            TKPDY  VP AVFS PP+  VGLSE+QA++E   D+ V+T++F P+K ++S   ++  MKLV+ ++T+KVLG  MCG DAPEI+QG AVA+K G TKA FD+ VG+HP+AAEEFV +RT TR++  SP S+  T
Sbjct:  363 TKPDYRDVPCAVFSIPPLSVVGLSEQQALEEAKSDVLVYTSSFNPMKNSISKRQEKTVMKLVVDSETDKVLGASMCGPDAPEIIQGMAVALKCGATKATFDSTVGIHPSAAEEFVTMRTLTRRV--SPSSKPKT 494          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRC_ARATH (Glutathione reductase, cytosolic OS=Arabidopsis thaliana GN=At3g24170 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.747e-32
Identity = 68/128 (53.12%), Postives = 94/128 (73.44%), Query Frame = -3
Query:  228 TKPDYSAVPSAVFSQPPIGQVGLSEEQAIQEY-GDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKIRKSP 608
            TK +YS V  AVF  PP+  VGLSEE+A+++  GDI VFT+ F P+K T+SG  ++  MKL++  K++KV+G  MCG DA EI+QG A+A+K G TKA FD+ VG+HP++AEEFV +R+ TR+I   P
Sbjct:  366 TKAEYSNVACAVFCIPPLAVVGLSEEEAVEQATGDILVFTSGFNPMKNTISGRQEKTLMKLIVDEKSDKVIGASMCGPDAAEIMQGIAIALKCGATKAQFDSTVGIHPSSAEEFVTMRSVTRRIAHKP 493          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHRC_BRARP (Glutathione reductase, cytosolic OS=Brassica rapa subsp. pekinensis GN=GR1 PE=2 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 3.891e-32
Identity = 68/123 (55.28%), Postives = 92/123 (74.80%), Query Frame = -3
Query:  240 KPDYSAVPSAVFSQPPIGQVGLSEEQAIQEY-GDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTRKI 605
            K DY+ V  AVF  PP+  VGLSEE+A+++  GDI VFT+ F P+K T+SG  ++  MKL++  KT+KV+G  MCG DA EI+QG A+A+K G TKA FD+ VG+HP++AEEFV +RT TR+I
Sbjct:  370 KADYTNVACAVFCIPPLAVVGLSEEEAVEKATGDILVFTSGFNPMKNTISGRQEKSLMKLIVDEKTDKVIGASMCGPDAAEIMQGIAIALKCGATKAQFDSTVGIHPSSAEEFVTMRTVTRRI 492          
BLAST of CB304784 vs. ExPASy Swiss-Prot
Match: GSHR_PSEAE (Glutathione reductase OS=Pseudomonas aeruginosa GN=gor PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.083e-29
Identity = 64/118 (54.24%), Postives = 84/118 (71.19%), Query Frame = -3
Query:  246 DYSAVPSAVFSQPPIGQVGLSEEQAIQEYGDIDVFTANFRPLKATLSGLPDRIFMKLVLCAKTNKVLGLPMCGEDAPEIVQGFAVAVKAGLTKADFDAPVGVHPTAAEEFVPLRTPTR 599
            DY  +P+AVFS P IG VGL+EE+A+     + +F + FRP+K TL+   ++  MKLV+ A  ++VLG  M G +A EI+QG AVA+KAG TK  FD  +G+HPTAAEEFV LRTPTR
Sbjct:  334 DYKLIPTAVFSLPNIGTVGLTEEEALSAGHKVKIFESRFRPMKLTLTDDQEKTLMKLVVDAHDDRVLGCHMVGAEAGEILQGIAVAMKAGATKQAFDETIGIHPTAAEEFVTLRTPTR 451          
The following BLAST results are available for this feature:
BLAST of CB304784 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 53
Match NameE-valueIdentityDescription
GSHRP_SOYBN5.948e-6583.92Glutathione reductase, chloroplastic OS=Glycine ma... [more]
GSHRP_TOBAC1.791e-6179.02Glutathione reductase, chloroplastic (Fragment) OS... [more]
GSHRP_ARATH2.586e-6078.32Glutathione reductase, chloroplastic OS=Arabidopsi... [more]
GSHRP_PEA4.129e-5875.35Glutathione reductase, chloroplastic/mitochondrial... [more]
GSHRC_PEA1.292e-3556.45Glutathione reductase, cytosolic OS=Pisum sativum ... [more]
GSHRP_SPIOL3.760e-3558.87Glutathione reductase, chloroplastic (Fragment) OS... [more]
GSHRC_ORYSJ1.094e-3455.97Glutathione reductase, cytosolic OS=Oryza sativa s... [more]
GSHRC_ARATH1.747e-3253.13Glutathione reductase, cytosolic OS=Arabidopsis th... [more]
GSHRC_BRARP3.891e-3255.28Glutathione reductase, cytosolic OS=Brassica rapa ... [more]
GSHR_PSEAE3.083e-2954.24Glutathione reductase OS=Pseudomonas aeruginosa GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_H01 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_H01 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304784 ID=CB304784|Name=CB304784|organism=Citrus sinensis|type=EST|length=610bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGAGTCCACCTTGAAGGGTAT
ATAACAGAGAAATAACAGTAAATCTAAATGAACATATCCTTAATCCTACT
CAGCAAGAAATACTGACACCTACTCGCCTTGAAATTGCCTTCTAAAACAT
GCAGCAAATTGATTGCTTCTACTCTACTAAACTCCTGCTGCAGCCTTAAC
CTCAGGACCAGTCATTCCCTCAGACGGAGGGCTCTTTCTGATCTTCCGAG
TAGGCGTCCTCAATGGGACAAACTCCTCTGCTGCCGTTGGATGAACACCC
ACTGGGGCATCAAAGTCTGCCTTAGTCAGACCAGCTTTGACAGCAACAGC
AAATCCCTGCACAATTTCAGGGGCATCTTCTCCACACATGGGCAAACCCA
GAACTTTGTTCGTCTTTGCACATAATACAAGTTTCATGAAGATCCTGTCT
GGAAGCCCAGAGAGAGTAGCTTTTAGTGGTCTGAAATTTGCTGTGAAGAC
ATCAATGTCACCATATTCTTGTATAGCCTGTTCTTCAGAAAGACCAACTT
GTCCAATTGGTGGCTGAGAAAAGACTGCAGATGGAACAGCGCTGTAATCA
GGTTTTGTTG
back to top