CB304793

Overview
NameCB304793
Unique NameCB304793
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length585
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11598 contig Csv1_Contig11598:259..843. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 7.121e-89
Identity = 167/186 (89.78%), Postives = 168/186 (90.32%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQLLQDFFNGKELCKS NPDE          AILSGEGNEKVQDLLLLDVTP SLGLETAGGVMTVLIPRNTTIP KKEQVFSTY DNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANG LNVSAEDKT GQKNKITI NDKGRLSK+EIEKMVQEAE
Sbjct:  344 GGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGTLNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE 529          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 325.094 bits (832), Expect = 1.586e-88
Identity = 166/186 (89.25%), Postives = 167/186 (89.78%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQLLQDFFNGKELCKS NPDE          AILSGEGNEKVQDLLLLDVTP SLGLETAGGVMT LIPRNTTIP KKEQVFSTY DNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT GQKNKITI NDKGRLSKDEIEKMVQEAE
Sbjct:  344 GGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAE 529          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 322.398 bits (825), Expect = 1.028e-87
Identity = 165/186 (88.71%), Postives = 166/186 (89.25%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQLLQDFFNGKELCKS NPDE          AILSGEGNEKVQDLLLLDVTP SLGLETAGGVMTVLIPRNTTIP KKEQVFSTY DNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPP PRGVPQI VCFDIDANGILNVSAEDKT GQKNKI I NDKGRLSK+EIEKMVQEAE
Sbjct:  344 GGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPGPRGVPQINVCFDIDANGILNVSAEDKTTGQKNKIRITNDKGRLSKEEIEKMVQEAE 529          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 2.291e-87
Identity = 164/186 (88.17%), Postives = 167/186 (89.78%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQLLQDFFNGKELCKS NPDE          AILSGEGNEKVQDLLLLDVTP SLGLETAGG MTVLIPRNTTIP KKEQVFSTY DNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT GQKNKITI NDKGRLSK+EIE+MVQEAE
Sbjct:  344 GGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGGMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAE 529          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.992e-87
Identity = 165/186 (88.71%), Postives = 166/186 (89.25%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQLL DFFNGKELCKS NPDE          AILSGEGNEKVQDLLLLDVTP SLGLETAGGVMTVLI RNTTIP KKEQVFSTY DNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT GQKNKITI NDKGRLSKDEIEKMVQEAE
Sbjct:  344 GGSTRIPKVQQLLVDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAE 529          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 7.369e-86
Identity = 161/186 (86.56%), Postives = 166/186 (89.25%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQLLQDFFNGKELCKS NPDE          AILSGEGNEKVQDLLLLDVTP SLGLETAGGVMT LI RNTTIP KKEQVFSTY DNQPGVLIQV+EGER RT+DNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKT G+KNKITI NDKGRLSK++IEKMVQEAE
Sbjct:  344 GGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGKKNKITITNDKGRLSKEDIEKMVQEAE 529          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 9.008e-84
Identity = 155/186 (83.33%), Postives = 165/186 (88.71%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKV QLLQDFFNGKELCKS NPDE          AILSG+G+EKVQDLLLLDVTP SLGLETAGGVMTVLIPRNTTIP KKEQ+FSTY DNQPGVLIQV+EGER RT+DNNLLGKFEL+GIPPAPRGVPQ+ VCFDIDANGILNVSAEDKT G KNKITI NDKGRLSK+EIEKMV++AE
Sbjct:  343 GGSTRIPKVHQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGQGDEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELTGIPPAPRGVPQVNVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIEKMVKDAE 528          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP70_CHLRE (Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2)

HSP 1 Score: 308.531 bits (789), Expect = 1.537e-83
Identity = 159/186 (85.48%), Postives = 163/186 (87.63%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQLLQDFFNGKEL KS NPDE          AIL+GEG EKVQDLLLLDVTP SLGLETAGGVMTVLIPRNTTIP KKEQVFSTY DNQPGVLIQVYEGER RT+DNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSAEDKT G KNKITI NDKGRLSKDEIE+MVQEAE
Sbjct:  344 GGSTRIPKVQQLLQDFFNGKELNKSINPDEAVAYGAAVQAAILTGEGGEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQINVIFDIDANGILNVSAEDKTTGNKNKITITNDKGRLSKDEIERMVQEAE 529          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.101e-81
Identity = 160/188 (85.11%), Postives = 165/188 (87.77%), Query Frame = -1
Query:   28 GGFTRIPKVQQL-LQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGE-RTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQ+ + +FFNGKELCKS NPDE          AILSGEGNEKVQDLLLLDVTP SLGLETAGGVMTVLIPRNTTIP KKEQVFSTY DNQPGVLIQV+EGE R RTRDNNLLGKFELS IPPAPR VPQITVCFDIDANGILNVSAEDKT GQKNKITI NDKGRLSK+EIEKMVQEAE
Sbjct:  344 GGSTRIPKVQQVAMTNFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERRARTRDNNLLGKFELSVIPPAPRVVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE 531          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 301.982 bits (772), Expect = 1.438e-81
Identity = 159/186 (85.48%), Postives = 162/186 (87.10%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TRIPKVQQL QDFFNGKELCKS NPDE          AILSGEGNE+  DLLLLDVTP SLGLETAGGVMTVLIPRNTTIP KKEQVFSTY DNQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQITV FDID N ILNVSAEDKT GQKNKITI NDKGRLSK+EIEKMVQEAE
Sbjct:  342 GGSTRIPKVQQL-QDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNER-SDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVTFDIDVNNILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE 525          
The following BLAST results are available for this feature:
BLAST of CB304793 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP72_SOLLC7.121e-8989.78Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP71_ARATH1.586e-8889.25Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP7E_SPIOL1.028e-8788.71Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP7C_PETHY2.291e-8788.17Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP73_ARATH2.992e-8788.71Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP72_ARATH7.369e-8686.56Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP70_SOYBN9.008e-8483.33Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP70_CHLRE1.537e-8385.48Heat shock 70 kDa protein OS=Chlamydomonas reinhar... [more]
HSP71_SOLLC1.101e-8185.11Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP70_MAIZE1.438e-8185.48Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IVaR_A03 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IVaR_A03 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304793 ID=CB304793|Name=CB304793|organism=Citrus sinensis|type=EST|length=585bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCGCCTCTTGAACCATCTTCT
CAATTTCATCCTTTGAAAGTCTTCCTTTGTCATTAGCGATGGTGATCTTG
TTCTTTTGACCAGGGGTCTTGTCCTCGGCAGACACATTCAGGATACCATT
GGCATCGATGTCGAAGCACACAGTGATTTGAGGAACACCCCTAGGAGCTG
GGGGAATACCAGAGAGCTCGAATTTACCCAACAAGTTATTGTCCCTGGTT
CTTGTCCTTTCACCTTCATAAACTTGGATCAACACACCAGGTTGGTTGTC
AAAGTAAGTTGAAAAAACCTGCTCCTTCTTGGGGGGAATGGTCGTGTTCC
TTGGAATCAACACAGTCATGACACCACCAGCAGTCTCCAAACCAAGGGAG
AAAGGCGTGACATCCAATAGCAAAAGATCCTGCACCTTCTCATTACCCTC
ACCACTCAAGATAGCAGCTTGCACAGCAGCACCATAGGCAACAGCCTCAT
CGGGGTTGGTGCTCTTGCAAAGCTCCTTCCCATTAAAGAAATCTTGCAAA
AGCTGCTGGACTTTGGGAATCCTAGTAAATCCTCC
back to top