CB304800

Overview
NameCB304800
Unique NameCB304800
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length599
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: RBD2A_ARATH (Ras-related protein RABD2A OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3)

HSP 1 Score: 128.642 bits (322), Expect = 2.283e-29
Identity = 62/70 (88.57%), Postives = 68/70 (97.14%), Query Frame = -3
Query:  388 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCCFT 597
            ETAKAFADEIGIPFMETSAKD+TNVEQAFMAM+ASIK+RMASQP+ NNARPPTVQI+GQPVAQK+GCC T
Sbjct:  134 ETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASIKERMASQPAGNNARPPTVQIRGQPVAQKNGCCST 203          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: YPTM2_MAIZE (GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.531e-25
Identity = 56/68 (82.35%), Postives = 63/68 (92.65%), Query Frame = -3
Query:  394 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 597
            ETAKAFADE+GIPFMETSAK++TNV+QAFMAMAASIKDRMASQP+  NARP TVQI+GQPV QK+ CC
Sbjct:  134 ETAKAFADEMGIPFMETSAKNATNVQQAFMAMAASIKDRMASQPAAANARPATVQIRGQPVNQKTSCC 201          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: RIC1_ORYSJ (Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 7.864e-22
Identity = 48/68 (70.59%), Postives = 58/68 (85.29%), Query Frame = -3
Query:  394 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 597
            E  KA ADEIGIPF+ETSAKD+TNVE+AFM MA  IK+RMASQP+ N ++P TVQ++GQPVAQ+S CC
Sbjct:  134 EAGKALADEIGIPFLETSAKDATNVEKAFMTMAGEIKNRMASQPATNASKPATVQMRGQPVAQQSSCC 201          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: YPTC1_CHLRE (GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.937e-16
Identity = 44/67 (65.67%), Postives = 52/67 (77.61%), Query Frame = -3
Query:  394 AKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQ-IKGQPVAQKSGCC 591
            AKAFADEIGIPF+ETSAK++TNVEQAFM MAA IK+RMASQP    A  P V+  +G+P+  KS  C
Sbjct:  136 AKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMASQPIPTKAGGPVVRPQEGKPINSKSSSC 202          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: RABD1_ARATH (Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.448e-16
Identity = 41/69 (59.42%), Postives = 52/69 (75.36%), Query Frame = -3
Query:  394 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMN-NARPPTVQIKGQPVAQKSGCC 597
            ET +A ADE+GIPF+ETSAKDS NVEQAF+ +A  IK +M SQ + N  + P TVQ+KGQP+ Q +G C
Sbjct:  134 ETGRALADELGIPFLETSAKDSINVEQAFLTIAGEIKKKMGSQTNANKTSGPGTVQMKGQPIQQNNGGC 202          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: YPTV1_VOLCA (GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.100e-15
Identity = 43/69 (62.32%), Postives = 52/69 (75.36%), Query Frame = -3
Query:  394 ETAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQ-IKGQPVAQKSGCC 597
            + AKAFADEIGIPF+ETSAK++TNVEQAFM MAA IK+RMASQP       P V+  +G+P+  KS  C
Sbjct:  134 QAAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMASQPVPPKPGGPVVRPTEGKPINNKSSSC 202          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: RAB1A_DICDI (Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.621e-14
Identity = 40/68 (58.82%), Postives = 48/68 (70.59%), Query Frame = -3
Query:  394 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRM-ASQPSMNNARPPTVQIKGQPVAQKSGCC 594
            TAKAFAD + IPF+ETSAK STNVEQAFM MA  IK+R+ ASQP+    +   V     P++ KSGCC
Sbjct:  135 TAKAFADSLQIPFLETSAKQSTNVEQAFMTMATEIKNRLTASQPTQTVDKNKVVPGSSAPISPKSGCC 202          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: RAB1A_RAT (Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 2.995e-13
Identity = 37/67 (55.22%), Postives = 45/67 (67.16%), Query Frame = -3
Query:  394 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 594
            TAK FAD +GIPF+ETSAK++TNVEQ+FM MAA IK RM    +   A    V+I+  PV Q  G C
Sbjct:  138 TAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: RAB1A_PIG (Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 2.995e-13
Identity = 37/67 (55.22%), Postives = 45/67 (67.16%), Query Frame = -3
Query:  394 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 594
            TAK FAD +GIPF+ETSAK++TNVEQ+FM MAA IK RM    +   A    V+I+  PV Q  G C
Sbjct:  138 TAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of CB304800 vs. ExPASy Swiss-Prot
Match: RAB1A_MOUSE (Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 2.995e-13
Identity = 37/67 (55.22%), Postives = 45/67 (67.16%), Query Frame = -3
Query:  394 TAKAFADEIGIPFMETSAKDSTNVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 594
            TAK FAD +GIPF+ETSAK++TNVEQ+FM MAA IK RM    +   A    V+I+  PV Q  G C
Sbjct:  138 TAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
The following BLAST results are available for this feature:
BLAST of CB304800 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
RBD2A_ARATH2.283e-2988.57Ras-related protein RABD2A OS=Arabidopsis thaliana... [more]
YPTM2_MAIZE1.531e-2582.35GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=... [more]
RIC1_ORYSJ7.864e-2270.59Ras-related protein RIC1 OS=Oryza sativa subsp. ja... [more]
YPTC1_CHLRE4.937e-1665.67GTP-binding protein YPTC1 OS=Chlamydomonas reinhar... [more]
RABD1_ARATH6.448e-1659.42Ras-related protein RABD1 OS=Arabidopsis thaliana ... [more]
YPTV1_VOLCA1.100e-1562.32GTP-binding protein yptV1 OS=Volvox carteri GN=YPT... [more]
RAB1A_DICDI4.621e-1458.82Ras-related protein Rab-1A OS=Dictyostelium discoi... [more]
RAB1A_RAT2.995e-1355.22Ras-related protein Rab-1A OS=Rattus norvegicus GN... [more]
RAB1A_PIG2.995e-1355.22Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A ... [more]
RAB1A_MOUSE2.995e-1355.22Ras-related protein Rab-1A OS=Mus musculus GN=Rab1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IVaR_B01 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IVaR_B01 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304800 ID=CB304800|Name=CB304800|organism=Citrus sinensis|type=EST|length=599bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGGAAAAAACAAATTCCAA
TTAAATACGCTCTCTATACCAAACAATGTAGCATACAATTAAACAAATTA
TTGGTTCAAGTCTTCAATAACCGCTGTCAAAACGGACAATAGTAGTGCTA
TTGACAGTATTCAAACATGCTATTAAGGCCAATTCACAATAAAGAATAGG
ACAGAAAGAAAAATACTAACATCAAATTAGCATTTCTACTTTGTACAGGC
CTTTTCATAAACCACAAAGGGAGAACAATTTTTGATGAGGTTGGTCCAAA
TGACATAGCTTTCAACTGAAAAGATGAAAAGCATTACACACCATTAGGTC
CAGCAAACCCACGACAGATATATTACAATGATACTTAAGTAAAGCAGCAG
CCACTCTTCTGTGCAACAGGCTGCCCTTTGATCTGTACAGTTGGAGGCCT
TGCATTGTTCATGGATGGTTGACTTGCCATTCTATCCTTGATTGAAGCAG
CCATGGCCATGAATGCCTGTTCCACGTTGGTAGAATCTTTTGCACTAGTT
TCCATGAAAGGTATTCCAATTTCATCTGCAAATGCCTTGGCTGTTTCAT
back to top