CB304801

Overview
NameCB304801
Unique NameCB304801
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length699
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig738 contig Csv1_Contig738:87..793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: IVD_ARATH (Isovaleryl-CoA dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=IVD PE=1 SV=2)

HSP 1 Score: 330.487 bits (846), Expect = 5.305e-90
Identity = 158/176 (89.77%), Postives = 170/176 (96.59%), Query Frame = -3
Query:  170 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGRKLLKQQ 697
            GSDTCELVFENCFVP EN+L +EGKGVYV+MSGLDLERLVLAAGPLGIMQAC+D VLPY+RQREQFGRP+GEFQFIQGK ADMYTALQSSRSYVYSVARDCDNGKVDPKDCAG ILCAAERATQVALQAIQCLGGNGY+NEYATGRLLRDAKLYEIGAGTSEIRR++IGR+L K++
Sbjct:  234 GSDTCELVFENCFVPEENILDKEGKGVYVLMSGLDLERLVLAAGPLGIMQACLDNVLPYIRQREQFGRPVGEFQFIQGKVADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGTILCAAERATQVALQAIQCLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRIVIGRELFKEE 409          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: IVD1_SOLTU (Isovaleryl-CoA dehydrogenase 1, mitochondrial OS=Solanum tuberosum GN=IVD1 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 3.218e-87
Identity = 152/176 (86.36%), Postives = 167/176 (94.89%), Query Frame = -3
Query:  170 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGRKLLKQQ 697
            GSDTCELVFENCFVP ENVLGQEGKGVYV+MSGLDLERLVLAAGP+GIMQAC+D+V+PYVRQREQFGRP+GEFQ IQGK ADMYTALQSSRSYVY+VA+DCDNGK+DPKDC+G IL AAERATQVALQAIQCLGGNGY+NEY TGRLLRDAK+YEI AGTSEIRR++IGR+L K Q
Sbjct:  237 GSDTCELVFENCFVPKENVLGQEGKGVYVLMSGLDLERLVLAAGPVGIMQACMDIVIPYVRQREQFGRPIGEFQLIQGKLADMYTALQSSRSYVYAVAKDCDNGKIDPKDCSGTILLAAERATQVALQAIQCLGGNGYINEYPTGRLLRDAKMYEIAAGTSEIRRLVIGRELFKHQ 412          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: IVD2_SOLTU (Isovaleryl-CoA dehydrogenase 2, mitochondrial (Fragment) OS=Solanum tuberosum GN=IVD2 PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.766e-85
Identity = 151/176 (85.80%), Postives = 167/176 (94.89%), Query Frame = -3
Query:  170 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGRKLLKQQ 697
            GSDTCELVFENCFVP ENVLGQ GKGVYV+MSGLDLERLVLA+GP+GIMQAC+DVVLPYV+QREQFGRP+GEFQF+QGK ADMYT++QSSRSY+YSVAR+CD+G ++ KDCAGVIL AAERATQVALQAIQCLGGNGYVNEY TGR LRDAKLYEIGAGTSEIRRMIIGR+L K+Q
Sbjct:  226 GSDTCELVFENCFVPEENVLGQVGKGVYVLMSGLDLERLVLASGPVGIMQACLDVVLPYVKQREQFGRPIGEFQFVQGKVADMYTSMQSSRSYLYSVARECDSGTINTKDCAGVILSAAERATQVALQAIQCLGGNGYVNEYPTGRFLRDAKLYEIGAGTSEIRRMIIGRELFKEQ 401          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: IVD_MOUSE (Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Ivd PE=1 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.398e-66
Identity = 121/170 (71.18%), Postives = 141/170 (82.94%), Query Frame = -3
Query:  188 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGR 697
            GS+TCELVFE+C VP  NVL QE KGVYV+MSGLDLERLVLA GPLGIMQA +D  +PY+  RE FG+ +G+FQ +QGK ADMYT L +SR YVY+VA+ CD G + PKDCAGVIL AAE ATQVAL  IQCLGGNGY+N++  GR LRDAKLYEIGAGTSE+RR++IGR
Sbjct:  248 GSNTCELVFEDCKVPAANVLSQESKGVYVLMSGLDLERLVLAGGPLGIMQAVLDHTIPYLHVREAFGQKIGQFQLMQGKMADMYTRLMASRQYVYNVAKACDEGHIIPKDCAGVILYAAECATQVALDGIQCLGGNGYINDFPMGRFLRDAKLYEIGAGTSEVRRLVIGR 417          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: IVD_RAT (Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Ivd PE=1 SV=2)

HSP 1 Score: 245.358 bits (625), Expect = 2.244e-64
Identity = 117/170 (68.82%), Postives = 137/170 (80.59%), Query Frame = -3
Query:  188 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGR 697
            GS+TCELVFE+C VP  N+L QE KGVYV+MSGLDLERLVLA GPLGIMQA +D  +PY+  RE FG+ +G+FQ +QGK ADMYT L + R YVY+VAR CD G +  KDCAGVIL  AE ATQVAL  IQCLGGNGY+N++  GR LRDAKLYEIG GTSE+RR++IGR
Sbjct:  248 GSNTCELVFEDCKVPAANILSQESKGVYVLMSGLDLERLVLAGGPLGIMQAVLDHTIPYLHVREAFGQKIGQFQLMQGKMADMYTRLMACRQYVYNVARACDEGHITAKDCAGVILYTAECATQVALDGIQCLGGNGYINDFPMGRFLRDAKLYEIGGGTSEVRRLVIGR 417          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: IVD_BOVIN (Isovaleryl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=IVD PE=2 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 5.000e-64
Identity = 117/170 (68.82%), Postives = 137/170 (80.59%), Query Frame = -3
Query:  188 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGR 697
            GS+TCELVFE+C VP  N+LG  GKGVYV+MSGLDLERLVLA GPLGIMQA +D  +PY+  RE FG+ +G FQ +QGK ADMYT L + R YVY+VA+ CD G    KDCAGVIL +AE ATQVAL  IQCLGGNGY+N++  GR LRDAKLYEIGAGTSE+RR++IGR
Sbjct:  250 GSNTCELVFEDCEVPAANILGHLGKGVYVLMSGLDLERLVLAGGPLGIMQAVLDHTIPYLHMREAFGQKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACDEGHCTTKDCAGVILYSAECATQVALDGIQCLGGNGYINDFPMGRFLRDAKLYEIGAGTSEVRRLVIGR 419          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: IVD_PONAB (Isovaleryl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=IVD PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.241e-63
Identity = 114/170 (67.06%), Postives = 136/170 (80.00%), Query Frame = -3
Query:  188 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGR 697
            GS+TCEL+FE+C VP  N+LG E KGVYV+MSGLDLERLVLA GPLG+MQA +D  +PY+  RE FG+ +G FQ +QGK ADMYT L + R YVY+VA+ CD G    KDCAGVIL +AE ATQVAL  IQC GGNGY+N++  GR LRDAKLYEIGAGTSE+RR++IGR
Sbjct:  247 GSNTCELIFEDCKVPAANILGHENKGVYVLMSGLDLERLVLAGGPLGLMQAVLDHTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACDEGHCTAKDCAGVILYSAECATQVALDGIQCFGGNGYINDFPMGRFLRDAKLYEIGAGTSEVRRLVIGR 416          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: IVD_HUMAN (Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=IVD PE=1 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 4.233e-63
Identity = 113/170 (66.47%), Postives = 136/170 (80.00%), Query Frame = -3
Query:  188 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGR 697
            GS+TCEL+FE+C +P  N+LG E KGVYV+MSGLDLERLVLA GPLG+MQA +D  +PY+  RE FG+ +G FQ +QGK ADMYT L + R YVY+VA+ CD G    KDCAGVIL +AE ATQVAL  IQC GGNGY+N++  GR LRDAKLYEIGAGTSE+RR++IGR
Sbjct:  247 GSNTCELIFEDCKIPAANILGHENKGVYVLMSGLDLERLVLAGGPLGLMQAVLDHTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACDEGHCTAKDCAGVILYSAECATQVALDGIQCFGGNGYINDFPMGRFLRDAKLYEIGAGTSEVRRLVIGR 416          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: ACDC_BACSU (Probable acyl-CoA dehydrogenase yngJ OS=Bacillus subtilis GN=yngJ PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.785e-33
Identity = 79/174 (45.40%), Postives = 108/174 (62.07%), Query Frame = -3
Query:  176 GSDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGRKLLK 697
            GS+T E++ E+  VP  N+LG   KG    +  LD  R+ +AA  +GI QA +D  L Y ++R+QFG+P+  FQ IQ K ADM   +  +R  V   A   D+ +   K+ A   L A+E AT+   QAIQ  GG+GY+ EY   R+LRDAKL EIG GTSEI+R++I R+LLK
Sbjct:  207 GSNTAEILLEDVRVPAANLLGDPTKGFKQFLYTLDGGRISIAALAVGIAQAALDASLAYAKERKQFGQPISSFQAIQFKLADMAMEIDLARQMVLKAAWLKDHNRPFTKEAAYAKLFASEMATRACNQAIQIHGGSGYMKEYGVERMLRDAKLMEIGEGTSEIQRLVIARQLLK 380          
BLAST of CB304801 vs. ExPASy Swiss-Prot
Match: ACADS_RAT (Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acads PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 1.328e-32
Identity = 78/173 (45.09%), Postives = 104/173 (60.12%), Query Frame = -3
Query:  176 SDTCELVFENCFVPNENVLGQEGKGVYVMMSGLDLERLVLAAGPLGIMQACIDVVLPYVRQREQFGRPLGEFQFIQGKTADMYTALQSSRSYVYSVARDCDNGKVDPKDCAGVILCAAERATQVALQAIQCLGGNGYVNEYATGRLLRDAKLYEIGAGTSEIRRMIIGRKLLK 694
            S T  L+FE+C +P EN+LG+ G G  + M  LD+ R+ +A+  LGI QA +D  + Y   R  FG PL + Q IQ K ADM  AL+S+R   +  A   DN K   K+ A   L A+E AT ++ QAIQ LGG GYV E    R  RDA++ EI  GTSEI+R++I   LL+
Sbjct:  236 SSTANLIFEDCRIPKENLLGEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENRHAFGAPLTKLQNIQFKLADMALALESARLLTWRAAMLKDNKKPFTKESAMAKLAASEAATAISHQAIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRLVIAGHLLR 408          
The following BLAST results are available for this feature:
BLAST of CB304801 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
IVD_ARATH5.305e-9089.77Isovaleryl-CoA dehydrogenase, mitochondrial OS=Ara... [more]
IVD1_SOLTU3.218e-8786.36Isovaleryl-CoA dehydrogenase 1, mitochondrial OS=S... [more]
IVD2_SOLTU1.766e-8585.80Isovaleryl-CoA dehydrogenase 2, mitochondrial (Fra... [more]
IVD_MOUSE2.398e-6671.18Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus... [more]
IVD_RAT2.244e-6468.82Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rat... [more]
IVD_BOVIN5.000e-6468.82Isovaleryl-CoA dehydrogenase, mitochondrial OS=Bos... [more]
IVD_PONAB3.241e-6367.06Isovaleryl-CoA dehydrogenase, mitochondrial OS=Pon... [more]
IVD_HUMAN4.233e-6366.47Isovaleryl-CoA dehydrogenase, mitochondrial OS=Hom... [more]
ACDC_BACSU7.785e-3345.40Probable acyl-CoA dehydrogenase yngJ OS=Bacillus s... [more]
ACADS_RAT1.328e-3245.09Short-chain specific acyl-CoA dehydrogenase, mitoc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IVaR_B03 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IVaR_B03 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304801 ID=CB304801|Name=CB304801|organism=Citrus sinensis|type=EST|length=699bp
TTTTNNNTTTTTTTTTTTTTTTTTTTCTTTGTAAAGTTGATAAACCGGTA
AATTTTATAATTCAGCACTTGTTCGTGCGTTCCCTGTTTCAAACCAAGGG
AATTTCACAATTTAAAATGAATATAAAAAGTATGTGCAAGTGAGAATCCT
ACAAAACGGCCATCTCTCACTGTTGCTTTAAAAGCTTGCGACCTATAATC
ATTCTTCTTATCTCGCTGGTGCCTGCCCCAATTTCATATAGTTTGGCATC
TCGAAGGAGACGTCCAGTGGCATACTCATTTACATAACCATTACCACCTA
AACATTGAATAGCCTGCAAAGCAACTTGGGTGGCTCTTTCAGCTGCACAA
AGTATCACTCCAGCACAGTCCTTAGGGTCAACTTTTCCGTTGTCACAGTC
CCTGGCAACAGAATAAACATAGGACCTTGATGATTGTAAAGCAGTATACA
TGTCAGCAGTTTTTCCCTGGATAAACTGAAATTCCCCAAGTGGACGGCCA
AATTGCTCCCGCTGACGAACATAAGGAAGAACAACATCAATGCATGCCTG
CATAATACCCAGGGGCCCAGCTGCCAAAACAAGCCTCTCCAAATCTAGTC
CTGACATCATAACATAAACTCCTTTTCCTTCCTGCCCAAGAACATTCTCA
TTTGGAACAAAGCAATTCTCAAACACAAGCTCACATGTATCACTTCCTC
back to top