CB304822

Overview
NameCB304822
Unique NameCB304822
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length599
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304822_ssr574 microsatellite CB304822_ssr574:574..588. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2614 contig Csv1_Contig2614:118..714. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.027e-21
Identity = 45/66 (68.18%), Postives = 53/66 (80.30%), Query Frame = -3
Query:  313 MSDTCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTRG 510
            MSDTCGNCDCAD +QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCT G
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 6.890e-18
Identity = 43/64 (67.19%), Postives = 48/64 (75.00%), Query Frame = -3
Query:  319 MSDTCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCT 510
            MSD CGNCDCAD SQCVKKG+S   D VETD S++   VVM V AAE+ G CKCG +C CVNCT
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIED-VVMGVPAAESGGKCKCGTSCPCVNCT 61          
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.466e-17
Identity = 38/64 (59.38%), Postives = 46/64 (71.88%), Query Frame = -3
Query:  310 TCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTRGS 501
            TCGNCDC D SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C  G+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.437e-15
Identity = 37/63 (58.73%), Postives = 44/63 (69.84%), Query Frame = -3
Query:  322 MSDTCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNC 510
            MS  C NCDC+D SQC KKG S+    VET+   + T V+MD  AAE  GNCKCGP+CACV+C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDT-VIMDAPAAENGGNCKCGPSCACVDC 62          
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.180e-15
Identity = 38/66 (57.58%), Postives = 45/66 (68.18%), Query Frame = -3
Query:  313 MSDTCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTRG 510
            MS  C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CT G
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.036e-14
Identity = 35/66 (53.03%), Postives = 41/66 (62.12%), Query Frame = -3
Query:  313 MSDTCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTRG 510
            MSD CGNCDCAD SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C  G
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.036e-14
Identity = 35/66 (53.03%), Postives = 41/66 (62.12%), Query Frame = -3
Query:  313 MSDTCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTRG 510
            MSD CGNCDCAD SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C  G
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 9.636e-12
Identity = 32/66 (48.48%), Postives = 39/66 (59.09%), Query Frame = -3
Query:  313 MSDTCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTRG 510
            MSD CGNCDCAD SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C  G
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of CB304822 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.662e-11
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = -3
Query:  313 MSDTCGNCDCADGSQCVKKGSSYAADFVETDMSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTRG 510
            MSD CG+CDCAD SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C  G
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of CB304822 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA1.027e-2168.18Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_ACTDE6.890e-1867.19Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_MUSAC4.466e-1759.38Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_PRUAV1.437e-1558.73Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO4.180e-1557.58Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ6.036e-1453.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI6.036e-1453.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ9.636e-1248.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI3.662e-1146.97Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IVaR_E04 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IVaR_E04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304822 ID=CB304822|Name=CB304822|organism=Citrus sinensis|type=EST|length=599bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTCAACTAACAATAATACATT
AAAATTAAACCACACAAGGCCACGGTCATGGCCATGGCCATATATTACAT
GATTATGAAGAAGGAAACACAAAACATTACGAGTGATGGGTGACACAACA
CGCACATCACTCCACACACTAGTAGTAGACCATCATAAAAACGAAGTAAA
GAATTTTTCTTTTTTTTTTTTAATCACCCTTACATTATTCTTAACCCCCA
CAATATTTAGGCACACTTGCAGCTTCTTATTTTTTGCTGCATGTGTTTGC
TTATTAGTGACTACCACGAGTGCAGTTCACACAAGCGCAGGTGGGGCCGC
ACTTGCAGTTACCTTCAGCCTCAGCAGCCTGAACGTCCATGACAACAACG
GTGCTGACAAAGCTCATGTCAGTCTCGACGAAGTCAGCAGCATAGCTGCT
TCCCTTCTTCACACACTGGCTCCCGTCAGCGCAGTCGCAGTTGCCGCAGG
TGTCCGACATGTTGATTGAGCTTAAAACTTAAAACTTAAAACTGGAAATA
GAGGGCTCTTTATTGTACGAAACTTGCTTTGCTTTGCTGTGATGATCCC
back to top