CB304827

Overview
NameCB304827
Unique NameCB304827
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: Y1567_ARATH (Uncharacterized UDP-glucosyltransferase At1g05670 OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.294e-63
Identity = 112/180 (62.22%), Postives = 140/180 (77.78%), Query Frame = -2
Query:  124 SVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVVRESEQFKLPENFAEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERGKEIRQNAGKWSNFAKEAVAKGGSSDKNIDDFVA 663
            SVVYVSFGS+  LK  ++ ELA GLK S  +FLWVVRE+E+ KLPEN+ EE  +KGL V+W PQLEVL H++ GCF+THCGWNST+E LSLGVPM+ MP W DQ TN+K M DVWK G++V AD  G VRRE     + E++E E+GKEIR+NA KW   A+EAV++GGSSDKNI++FV+
Sbjct:  271 SVVYVSFGSLVVLKKDQLIELAAGLKQSGHFFLWVVRETERRKLPENYIEEIGEKGLTVSWSPQLEVLTHKSIGCFVTHCGWNSTLEGLSLGVPMIGMPHWADQPTNAKFMEDVWKVGVRVKADSDGFVRREEFVRRVEEVMEAEQGKEIRKNAEKWKVLAQEAVSEGGSSDKNINEFVS 450          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: HTGT_ARATH (N-hydroxythioamide S-beta-glucosyltransferase OS=Arabidopsis thaliana GN=UGT74B1 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.908e-50
Identity = 90/183 (49.18%), Postives = 133/183 (72.68%), Query Frame = -2
Query:  118 SVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVVRESEQFKLPENFAEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPAD-DKGIVRREAIAHCIREILEGERGKEIRQNAGKWSNFAKEAVAKGGSSDKNIDDFVANL 663
            SV +VSFGS   L  K++ E+A  L+ SD  FLWV++E+   KLPE F E T  + L+V+WC QLEVLAHE+ GCFLTHCGWNST+E LSLGVPMV +PQW+DQ  ++K + +VWK G +   +  + IV+ E +  C++ ++EGE   +IR+++ KW + A +A+++GGSSD++I++F+ +L
Sbjct:  276 SVAFVSFGSFGILFEKQLAEVAIALQESDLNFLWVIKEAHIAKLPEGFVESTKDRALLVSWCNQLEVLAHESIGCFLTHCGWNSTLEGLSLGVPMVGVPQWSDQMNDAKFVEEVWKVGYRAKEEAGEVIVKSEELVRCLKGVMEGESSVKIRESSKKWKDLAVKAMSEGGSSDRSINEFIESL 458          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: IABG_MAIZE (Indole-3-acetate beta-glucosyltransferase OS=Zea mays GN=IAGLU PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.756e-47
Identity = 94/183 (51.37%), Postives = 125/183 (68.31%), Query Frame = -2
Query:  127 SVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVVRESEQFKLPENFAEETSQKG--LVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPAD-DKGIVRREAIAHCIREILE-GERGKEIRQNAGKWSNFAKEAVAKGGSSDKNIDDFV 663
            SV YVSFGS+A+L   + EELA GL A+ K FLWVVR S++ ++P     E +  G  +VV WCPQL+VLAH A GCF+THCGWNST+EALS GVPMVAM  WTDQ TN++ +   W  G++   D   G+  R  +  C+R +++ GE     R+ AG+W + A+ AVA GGSSD+N+D+FV
Sbjct:  279 SVAYVSFGSLASLGNAQKEELARGLLAAGKPFLWVVRASDEHQVPRYLLAEATATGAAMVVPWCPQLDVLAHPAVGCFVTHCGWNSTLEALSFGVPMVAMALWTDQPTNARNVELAWGAGVRARRDAGAGVFLRGEVERCVRAVMDGGEAASAARKAAGEWRDRARAAVAPGGSSDRNLDEFV 461          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: IABG1_ARATH (Indole-3-acetate beta-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT75B1 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.157e-45
Identity = 87/194 (44.85%), Postives = 125/194 (64.43%), Query Frame = -2
Query:  118 SVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVV------------RESEQFKLPENFAEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERGKEIRQNAGKWSNFAKEAVAKGGSSDKNIDDFVANL 663
            SV+YVSFG+M  L  K++EELA  L    + FLWV+             E  + +    F  E  + G++V+WC Q+EVL+H A GCF+THCGW+ST+E+L LGVP+VA P W+DQ TN+K + + WKTG++V  +  G+V R  I  C+  ++E E+  E+R+NA KW   A EA  +GGSSDKN++ FV ++
Sbjct:  259 SVIYVSFGTMVELSKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKDGLVERGEIRRCLEAVME-EKSVELRENAKKWKRLAMEAGREGGSSDKNMEAFVEDI 451          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: IABG2_ARATH (Indole-3-acetate beta-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT75B2 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.679e-45
Identity = 86/194 (44.33%), Postives = 124/194 (63.92%), Query Frame = -2
Query:  118 SVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVV------------RESEQFKLPENFAEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERGKEIRQNAGKWSNFAKEAVAKGGSSDKNIDDFVANL 663
            SV+YVSFG+M  L  K++EELA  L    + FLWV+             E  + +    F  E  + G++V+WC Q+EVL H A GCFLTHCGW+S++E+L LGVP+VA P W+DQ  N+K + ++WKTG++V  + +G+V R  I  C+  ++E  +  E+R+NA KW   A EA  +GGSSDKN++ FV +L
Sbjct:  262 SVIYVSFGTMVELSKKQIEELARALIEGGRPFLWVITDKLNREAKIEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLRHRAIGCFLTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEEIWKTGVRVRENSEGLVERGEIMRCLEAVMEA-KSVELRENAEKWKRLATEAGREGGSSDKNVEAFVKSL 454          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: UGAGT_ARATH (Anthocyanin 5-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT75C1 PE=2 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 4.209e-41
Identity = 87/184 (47.28%), Postives = 119/184 (64.67%), Query Frame = -2
Query:  127 SVVYVSFGSMAT-LKIKEMEELAWGLKASDKYFLWVVRESEQFKLPEN-FAE--ETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPADDKGIVRREAIAHCIREILE-GERGKEIRQNAGKWSNFAKEAVAKGGSSDKNIDDFV 663
            SV+Y+S G+ A  L  K ME L  G+ A+++ FLW+VRE    +  +N F E    S +GLVV WC Q  VLAH A GCF+THCGWNST+E+L  GVP+VA PQ+ DQ T +K + D W+ G+KV   ++G V  E I  C+ +++  GE  +E+R+NA KW   A +A A+GG SD N+  FV
Sbjct:  269 SVIYISLGTHADDLPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDGEEIRRCLEKVMSGGEEAEEMRENAEKWKAMAVDAAAEGGPSDLNLKGFV 452          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: LGT_CITUN (Limonoid UDP-glucosyltransferase OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.497e-41
Identity = 83/187 (44.39%), Postives = 119/187 (63.64%), Query Frame = -2
Query:  127 SVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVVRESEQ------FKLPENFAEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKV--PADDKGIVRREAIAHCIREILEGERGKEIRQNAGKWSNFAKEAVAKGGSSDKNIDDFV 663
            SVVY+SFG++  LK +++EE+ + L  S   FLWV++   +        LP+ F E+   KG VV W PQ +VLAH +  CF+THCGWNSTME+L+ GVP++  PQW DQ T++  + DV+KTGL++     +  I+ R+ +  C+ E   G +   + +NA KW   A+EAVA GGSSD+NI  FV
Sbjct:  275 SVVYISFGTVVYLKQEQVEEIGYALLNSGISFLWVMKPPPEDSGVKIVDLPDGFLEKVGDKGKVVQWSPQEKVLAHPSVACFVTHCGWNSTMESLASGVPVITFPQWGDQVTDAMYLCDVFKTGLRLCRGEAENRIISRDEVEKCLLEATAGPKAVALEENALKWKKEAEEAVADGGSSDRNIQAFV 461          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: COGT2_ARATH (Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT85A1 PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.497e-41
Identity = 83/193 (43.01%), Postives = 122/193 (63.21%), Query Frame = -2
Query:  103 SVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVVRES----EQFKLPENFAEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERGKEIRQNAGKWSNFAKEAVA-KGGSSDKNIDDFVAN-LISSKS 663
            SV+Y++FGS+  L +K++ E AWGL  S K FLWV+R      E+  +P +F  ET  + ++ +WCPQ +VL+H A G FLTHCGWNS +E+LS GVPMV  P + DQ  N K   D W  G+++  D    V+RE +   +RE+++GE+GK++R+ A +W   A++A   K GSS  N +  V+  L+  KS
Sbjct:  299 SVIYINFGSITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPDFLMETKDRSMLASWCPQEKVLSHPAIGGFLTHCGWNSILESLSCGVPMVCWPFFADQQMNCKFCCDEWDVGIEIGGD----VKREEVEAVVRELMDGEKGKKMREKAVEWQRLAEKATEHKLGSSVMNFETVVSKFLLGQKS 487          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: HMNGT_SORBI (Cyanohydrin beta-glucosyltransferase OS=Sorghum bicolor GN=UGT85B1 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.830e-36
Identity = 80/189 (42.33%), Postives = 116/189 (61.38%), Query Frame = -2
Query:  115 GSVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVVR----ESEQFKLPENFAEETSQ-KGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERGKEIRQNAGKWSNFAKEAVAKGGSSDKNIDDFVANLI 666
            GSVVYV+FGSMA +   +  E A GL +    FLWV R    E E+  LPE   +E ++ +GLVV WCPQ  VL H A G F++HCGWNS +EA + G P++A P   +Q+TN + + +VW  G ++P +    V   A+A  +RE++ G+ GKE R  A +W   A+ A  KGG+S +N++  V +L+
Sbjct:  302 GSVVYVNFGSMAVMTAAQAREFALGLASCGSPFLWVKRPDVVEGEEVLLPEALLDEVARGRGLVVPWCPQAAVLKHAAVGLFVSHCGWNSLLEATAAGQPVLAWPCHGEQTTNCRQLCEVWGNGAQLPRE----VESGAVARLVREMMVGDLGKEKRAKAAEWKAAAEAAARKGGASWRNVERVVNDLL 486          
BLAST of CB304827 vs. ExPASy Swiss-Prot
Match: UGFGT_ARATH (Flavonoid 3-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT78D2 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 7.689e-35
Identity = 73/188 (38.83%), Postives = 117/188 (62.23%), Query Frame = -2
Query:  115 NGSVVYVSFGSMATLKIKEMEELAWGLKASDKYFLWVVRESEQFKLPENFAEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWTDQSTNSKCMMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERGKEIRQNAGKWSNFAKEAVAKGGSSDKN---IDDFVANLI 669
            +GSV Y+SFG++ T    E+  +A GL++S   F+W ++E    +LP+ F + T ++G+VV W PQ+E+L HEATG F+THCGWNS +E++S GVPM+  P + DQ  N + +  VW+ G+ +     G+  ++    C+ ++L  + GK+++ NA K    A EAV+  G S +N   + D V N+I
Sbjct:  276 SGSVAYISFGTVMTPPPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTI---INGVFTKDGFEKCLDKVLVQDDGKKMKCNAKKLKELAYEAVSSKGRSSENFRGLLDAVVNII 460          
The following BLAST results are available for this feature:
BLAST of CB304827 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
Y1567_ARATH2.294e-6362.22Uncharacterized UDP-glucosyltransferase At1g05670 ... [more]
HTGT_ARATH2.908e-5049.18N-hydroxythioamide S-beta-glucosyltransferase OS=A... [more]
IABG_MAIZE8.756e-4751.37Indole-3-acetate beta-glucosyltransferase OS=Zea m... [more]
IABG1_ARATH2.157e-4544.85Indole-3-acetate beta-glucosyltransferase 1 OS=Ara... [more]
IABG2_ARATH3.679e-4544.33Indole-3-acetate beta-glucosyltransferase 2 OS=Ara... [more]
UGAGT_ARATH4.209e-4147.28Anthocyanin 5-O-glucosyltransferase OS=Arabidopsis... [more]
LGT_CITUN5.497e-4144.39Limonoid UDP-glucosyltransferase OS=Citrus unshiu ... [more]
COGT2_ARATH5.497e-4143.01Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis t... [more]
HMNGT_SORBI1.830e-3642.33Cyanohydrin beta-glucosyltransferase OS=Sorghum bi... [more]
UGFGT_ARATH7.689e-3538.83Flavonoid 3-O-glucosyltransferase OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IVaR_F02 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IVaR_F02 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304827 ID=CB304827|Name=CB304827|organism=Citrus sinensis|type=EST|length=670bp
TTTTTTTTTTTTTTTTTTTTTTNNNTTTTTGTCCTTGCTTTGGTAAAAAG
TATTACAAATTAAAGATATTACAAAAATCCAACAAAATTAAAGATATTAA
AAGCTTTTGGAGGAAATCAAGTTGGCAACAAAGTCATCAATATTTTTGTC
CGAACTTCCACCTTTAGCCACGGCTTCTTTGGCAAAATTGCTCCATTTAC
CAGCATTCTGTCTTATCTCTTTGCCTCTCTCACCCTCTAATATTTCACGA
ATGCAATGGGCAATTGCTTCTCTTCTGACAATTCCTTTGTCATCCGCTGG
AACTTTAAGTCCCGTTTTCCAGACATCCATCATGCACTTGGAATTAGTGC
TCTGATCAGTCCATTGGGGCATTGCCACCATTGGCACTCCCAAGCTCAGG
GCCTCCATTGTAGAGTTCCAGCCACAATGTGTCAAAAAGCATCCTGTTGC
TTCATGTGCCAAAACTTCTAATTGCGGGCACCAATTCACAACCAAGCCTT
TCTGGGATGTTTCTTCTGCAAAGTTTTCCGGAAGCTTAAATTGTTCGGAT
TCCCTTACAACCCACAAGAAATACTTGTCACTTGCTTTCAGACCCCAAGC
CAATTCTTCCATTTCCTTTATTTTTAGTGTTGCCATACTCCCAAATGATA
CATAAACAACAGACCCGTTT
back to top