CB304861

Overview
NameCB304861
Unique NameCB304861
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6145 contig Csv1_Contig6145:453..1044. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM_CAPAN (Superoxide dismutase [Mn], mitochondrial OS=Capsicum annuum GN=SODA PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 6.244e-48
Identity = 85/100 (85.00%), Postives = 94/100 (94.00%), Query Frame = -2
Query:  292 HFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQKECP 591
            +FGSLEA+IQKM+AEGAALQGSGWVWLGLD E KRLV+ETTANQDPLV K P LVPLLGIDVWEHAYYLQYKNVKPDYLKN+W V+NWKYA++VY+KECP
Sbjct:  129 NFGSLEAVIQKMNAEGAALQGSGWVWLGLDKELKRLVIETTANQDPLVIKGPNLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWKVINWKYAAEVYEKECP 228          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM_PRUPE (Superoxide dismutase [Mn], mitochondrial OS=Prunus persica GN=SOD PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.373e-47
Identity = 85/100 (85.00%), Postives = 94/100 (94.00%), Query Frame = -2
Query:  292 HFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQKECP 591
            +FGSLEAL+QKM+AEGAALQGSGWVWL LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKN+W V+NWKYAS+VY+KE P
Sbjct:  129 NFGSLEALVQKMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEVYEKESP 228          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM_NICPL (Superoxide dismutase [Mn], mitochondrial OS=Nicotiana plumbaginifolia GN=SODA PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.099e-47
Identity = 83/100 (83.00%), Postives = 94/100 (94.00%), Query Frame = -2
Query:  292 HFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQKECP 591
            +FGSLEAL+QKM+AEGAALQGSGWVWLG+D E KRLV+ETTANQDPLV+K   LVPLLGIDVWEHAYYLQYKNV+PDYLKN+W VMNWKYA++VY+KECP
Sbjct:  129 NFGSLEALVQKMNAEGAALQGSGWVWLGVDKELKRLVIETTANQDPLVSKGANLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYANEVYEKECP 228          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM_HEVBR (Superoxide dismutase [Mn], mitochondrial OS=Hevea brasiliensis GN=SODA PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.099e-47
Identity = 86/99 (86.87%), Postives = 91/99 (91.92%), Query Frame = -2
Query:  292 FGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQKECP 588
            FGSLE LIQ M+AEGAALQGSGWVWL LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKN+W VMNWKYAS+VY KECP
Sbjct:  133 FGSLEKLIQLMNAEGAALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMNWKYASEVYAKECP 231          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM_ARATH (Superoxide dismutase [Mn], mitochondrial OS=Arabidopsis thaliana GN=SODA PE=1 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 1.102e-44
Identity = 80/98 (81.63%), Postives = 92/98 (93.88%), Query Frame = -2
Query:  298 HFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQKE 591
            HFGSLE L++KMSAEGAA+QGSGWVWLGLD E K+LVV+TTANQDPLVTK  +LVPL+GIDVWEHAYYLQYKNV+P+YLKNVW V+NWKYAS+VY+KE
Sbjct:  132 HFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKE 229          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM_ORYSJ (Superoxide dismutase [Mn], mitochondrial OS=Oryza sativa subsp. japonica GN=SODA PE=2 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 8.733e-42
Identity = 77/95 (81.05%), Postives = 84/95 (88.42%), Query Frame = -2
Query:  304 FGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQ 588
            FGS EAL++KMSAEGAALQGSGWVWL LD E K+L VETTANQDPLVTK   LVPLLGIDVWEHAYYLQYKNV+PDYL N+W VMNWKYA +VY+
Sbjct:  133 FGSFEALVKKMSAEGAALQGSGWVWLALDKEAKKLSVETTANQDPLVTKGANLVPLLGIDVWEHAYYLQYKNVRPDYLSNIWKVMNWKYAGEVYE 227          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM1_MAIZE (Superoxide dismutase [Mn] 3.1, mitochondrial OS=Zea mays GN=SODA.4 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.318e-41
Identity = 75/95 (78.95%), Postives = 85/95 (89.47%), Query Frame = -2
Query:  304 FGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQ 588
            FGS EAL++KM+AEGAALQGSGWVWL LD E K++ VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL N+W VMNWKYA +VY+
Sbjct:  137 FGSFEALVKKMNAEGAALQGSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 231          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM4_MAIZE (Superoxide dismutase [Mn] 3.4, mitochondrial OS=Zea mays GN=SODA.3 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 5.660e-41
Identity = 75/95 (78.95%), Postives = 85/95 (89.47%), Query Frame = -2
Query:  304 FGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQ 588
            FGS EAL+++M+AEGAALQGSGWVWL LD E K+L VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL N+W VMNWKYA +VY+
Sbjct:  135 FGSFEALVKRMNAEGAALQGSGWVWLALDKEPKKLSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 229          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM2_MAIZE (Superoxide dismutase [Mn] 3.2, mitochondrial OS=Zea mays GN=SODA.1 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 5.660e-41
Identity = 75/95 (78.95%), Postives = 85/95 (89.47%), Query Frame = -2
Query:  304 FGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQ 588
            FGS EAL+++M+AEGAALQGSGWVWL LD E K+L VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL N+W VMNWKYA +VY+
Sbjct:  134 FGSFEALVKRMNAEGAALQGSGWVWLALDKEPKKLSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 228          
BLAST of CB304861 vs. ExPASy Swiss-Prot
Match: SODM3_MAIZE (Superoxide dismutase [Mn] 3.3, mitochondrial OS=Zea mays GN=SODA.2 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 7.393e-41
Identity = 74/95 (77.89%), Postives = 85/95 (89.47%), Query Frame = -2
Query:  304 FGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNVWNVMNWKYASDVYQ 588
            FGS EAL+++M+AEGAALQGSGWVWL LD E K++ VETTANQDPLVTK  +LVPLLGIDVWEHAYYLQYKNV+PDYL N+W VMNWKYA +VY+
Sbjct:  135 FGSFEALVKRMNAEGAALQGSGWVWLALDKEAKKVSVETTANQDPLVTKGASLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVMNWKYAGEVYE 229          
The following BLAST results are available for this feature:
BLAST of CB304861 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 188
Match NameE-valueIdentityDescription
SODM_CAPAN6.244e-4885.00Superoxide dismutase [Mn], mitochondrial OS=Capsic... [more]
SODM_PRUPE2.373e-4785.00Superoxide dismutase [Mn], mitochondrial OS=Prunus... [more]
SODM_NICPL3.099e-4783.00Superoxide dismutase [Mn], mitochondrial OS=Nicoti... [more]
SODM_HEVBR3.099e-4786.87Superoxide dismutase [Mn], mitochondrial OS=Hevea ... [more]
SODM_ARATH1.102e-4481.63Superoxide dismutase [Mn], mitochondrial OS=Arabid... [more]
SODM_ORYSJ8.733e-4281.05Superoxide dismutase [Mn], mitochondrial OS=Oryza ... [more]
SODM1_MAIZE3.318e-4178.95Superoxide dismutase [Mn] 3.1, mitochondrial OS=Ze... [more]
SODM4_MAIZE5.660e-4178.95Superoxide dismutase [Mn] 3.4, mitochondrial OS=Ze... [more]
SODM2_MAIZE5.660e-4178.95Superoxide dismutase [Mn] 3.2, mitochondrial OS=Ze... [more]
SODM3_MAIZE7.393e-4177.89Superoxide dismutase [Mn] 3.3, mitochondrial OS=Ze... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IaR_B11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IaR_B11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304861 ID=CB304861|Name=CB304861|organism=Citrus sinensis|type=EST|length=592bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTAGAAACCCAATCATACATATT
CACAGATCCGTGCTCATAGTGAGATACAAAAAGAGCATAAACCCCAATAT
TATTTTGGATGTCACATAAGGGATACACAAGTAACACTCACTGCAAAAGA
AAGGGTGTCTGTCATCAGTTGCAAATTATCGTTTTATTGTCACTTCAGCG
TGAAAAGCTGCAAGGGTATTCGCCTCTTGAACCCAAGAGAGAACCCAGAT
CAAACAAAGAACTCCATGCTCAAGGAAGAGCTCCAAGCTTAAGGGCATTC
TTTCTGATACACATCACTAGCATACTTCCAGTTCATTACGTTCCAAACGT
TTTTCAGATAATCTGGTTTGACATTCTTGTACTGTAGGTAGTATGCATGC
TCCCAAACATCTATACCAAGCAAAGGAACCAGAGTTGGGGCTTTAGTCAC
CAGTGGATCCTGATTTGCAGTAGTTTCAACCACAAGCCTTTTGAACTCTG
TATCTAAACCAAGCCACACCCATCCAGAGCCCTGCAAAGCTGCACCCTCA
GCACTCATCTTTTGTATCAATGCTTCCAGAGAACCAAAATGC
back to top