CB304865

Overview
NameCB304865
Unique NameCB304865
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length615
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: POT4_ARATH (Potassium transporter 4 OS=Arabidopsis thaliana GN=POT4 PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 3.543e-33
Identity = 75/103 (72.82%), Postives = 87/103 (84.47%), Query Frame = -3
Query:  215 VFDEDNP---VRRRQVRFQLP-SDPGMDPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 511
            V++++ P   VRRR VRFQL  S  GM   VREELMDLI+AKEAG+AYIMGHSYVK+R+SSS++K+  IDI YSFLRKNCRGP+VALNIP ISLIEVGMIYYV
Sbjct:  687 VYEDEYPQGQVRRRHVRFQLTASSGGMGSSVREELMDLIRAKEAGVAYIMGHSYVKSRKSSSWLKKMAIDIGYSFLRKNCRGPAVALNIPHISLIEVGMIYYV 789          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: HAK7_ORYSJ (Potassium transporter 7 OS=Oryza sativa subsp. japonica GN=HAK7 PE=2 SV=3)

HSP 1 Score: 133.265 bits (334), Expect = 9.650e-31
Identity = 62/91 (68.13%), Postives = 78/91 (85.71%), Query Frame = -3
Query:  215 RRRQVRFQLPSDPGMDPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 487
            RRR+VRF++  +  +DP VR+EL DL+ AKEAG+ YI+GHSYVKAR++S+F+K F ID  YSFLRKNCRGP+VAL+IP ISL+EVGMIYYV
Sbjct:  721 RRRRVRFEIAEEERIDPQVRDELADLLDAKEAGVTYIIGHSYVKARKNSNFLKTFAIDYAYSFLRKNCRGPAVALHIPHISLVEVGMIYYV 811          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: HAK2_ORYSJ (Probable potassium transporter 2 OS=Oryza sativa subsp. japonica GN=HAK2 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.104e-29
Identity = 60/97 (61.86%), Postives = 76/97 (78.35%), Query Frame = -3
Query:  215 DEDNPVRRRQVRFQLPSDPGMDPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 505
            +  N  RRR+VRF+LP +  MD  V++EL+ L++AK  G+ Y+MGH Y+KAR++SSF KRF ID+ YSFLRKNCRGPSV L+IP ISLIEVGM Y V
Sbjct:  687 ESPNVSRRRRVRFELPEEDDMDQQVKDELLALVEAKHTGVTYVMGHVYIKARKNSSFFKRFAIDVGYSFLRKNCRGPSVTLHIPHISLIEVGMAYQV 783          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: HAK3_ORYSJ (Probable potassium transporter 3 OS=Oryza sativa subsp. japonica GN=HAK3 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.905e-27
Identity = 58/90 (64.44%), Postives = 75/90 (83.33%), Query Frame = -3
Query:  215 RRQVRFQLPSDPGMDPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 484
            RR+VRF++ ++   DP V+EEL  L++AK AG+AYIMGHSY+KAR+SSS  K+F +++ Y+FLRKNCRGP + LNIP ISLIEVGMIYYV
Sbjct:  720 RRRVRFEV-ANQHTDPRVKEELSALVEAKHAGVAYIMGHSYIKARKSSSVFKKFAVNVAYAFLRKNCRGPGLVLNIPHISLIEVGMIYYV 808          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: HAK10_ORYSJ (Potassium transporter 10 OS=Oryza sativa subsp. japonica GN=HAK10 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.155e-22
Identity = 52/91 (57.14%), Postives = 69/91 (75.82%), Query Frame = -3
Query:  215 RRQVRFQLPS-DPGMDPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 484
            R++VRF LP+  P  D  VREEL +L+ A+EAG+A+I+GHSYVKA+  SSF +R +I+  Y FLR+N RGP+ A+ IP  S +EVGMIYYV
Sbjct:  753 RKRVRFVLPAASPRPDAGVREELQELMDAREAGMAFILGHSYVKAKSGSSFFRRLVINFCYDFLRRNSRGPNYAVTIPHASTLEVGMIYYV 843          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: POT3_ARATH (Potassium transporter 3 OS=Arabidopsis thaliana GN=POT3 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.188e-22
Identity = 49/90 (54.44%), Postives = 66/90 (73.33%), Query Frame = -3
Query:  215 RRQVRFQLPSDPGMDPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 484
            RR  +F+        P V+EEL DL+ AK+A +AYI+GH +VKA+R+S FVK+ ++++ YSFLRKNCR P V LNIP I LI+VGM YY+
Sbjct:  686 RRMFQFRPMDTKFRQPQVKEELFDLVNAKDAEVAYIVGHGHVKAKRNSVFVKQLVVNVAYSFLRKNCRSPGVMLNIPHICLIKVGMNYYL 775          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: HAK25_ORYSJ (Potassium transporter 25 OS=Oryza sativa subsp. japonica GN=HAK25 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.397e-21
Identity = 47/90 (52.22%), Postives = 66/90 (73.33%), Query Frame = -3
Query:  215 RRQVRFQLPSDPGMDPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 484
            R++ RF LP +  +D  VR EL +L+ A+EAG+++I+GHSY+KA+  SSF+KR +I+  Y FLR+N RGPS A  IP  S +EVGM+Y V
Sbjct:  681 RKKARFVLPKNAQVDSEVRRELQELMDAREAGMSFILGHSYMKAKSGSSFIKRIVINFFYEFLRRNSRGPSYAATIPHASTLEVGMVYQV 770          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: POT2_ARATH (Potassium transporter 2 OS=Arabidopsis thaliana GN=POT2 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 1.544e-20
Identity = 44/76 (57.89%), Postives = 61/76 (80.26%), Query Frame = -3
Query:  215 DPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 442
            D  +R EL DL+ A+EAG A+I+GHS+VKA++ SS +KR  ++  Y+FLR+NCRGP VAL +PP+SL+EVGM+Y V
Sbjct:  719 DAELRSELRDLLAAQEAGTAFILGHSHVKAKQGSSVMKRLAVNFGYNFLRRNCRGPDVALKVPPVSLLEVGMVYVV 794          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: POT1_ARATH (Potassium transporter 1 OS=Arabidopsis thaliana GN=POT1 PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.707e-19
Identity = 39/72 (54.17%), Postives = 60/72 (83.33%), Query Frame = -3
Query:  215 REELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 430
            +EE M++++AKEAG+AYI+GHSY KA++SSS +K+  ++++++F+  NCRG  V LN+P  SL+EVGM+YYV
Sbjct:  641 KEECMEIMEAKEAGVAYILGHSYAKAKQSSSVLKKLAVNVVFAFMSTNCRGTDVVLNVPHTSLLEVGMVYYV 712          
BLAST of CB304865 vs. ExPASy Swiss-Prot
Match: POT8_ARATH (Potassium transporter 8 OS=Arabidopsis thaliana GN=POT8 PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 8.473e-19
Identity = 45/94 (47.87%), Postives = 64/94 (68.09%), Query Frame = -3
Query:  215 NPVRRRQVRFQLPSDPGMDPVVREELMDLIQAKEAGIAYIMGHSYVKARRSSSFVKRFMIDILYSFLRKNCRGPSVALNIPPISLIEVGMIYYV 496
            +P  +++VRF LP    +D    EEL +L +A+EAG+A+IMGHSYV+A+  SS +K+  I+  Y FLR+N RGP   L+ P  S +EVGM+Y V
Sbjct:  688 SPRFKKRVRFVLPESARIDRSAEEELTELTEAREAGMAFIMGHSYVRAKSGSSVMKKIAINFGYDFLRRNSRGPCYGLSTPHASTLEVGMVYIV 781          
The following BLAST results are available for this feature:
BLAST of CB304865 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
POT4_ARATH3.543e-3372.82Potassium transporter 4 OS=Arabidopsis thaliana GN... [more]
HAK7_ORYSJ9.650e-3168.13Potassium transporter 7 OS=Oryza sativa subsp. jap... [more]
HAK2_ORYSJ3.104e-2961.86Probable potassium transporter 2 OS=Oryza sativa s... [more]
HAK3_ORYSJ2.905e-2764.44Probable potassium transporter 3 OS=Oryza sativa s... [more]
HAK10_ORYSJ2.155e-2257.14Potassium transporter 10 OS=Oryza sativa subsp. ja... [more]
POT3_ARATH8.188e-2254.44Potassium transporter 3 OS=Arabidopsis thaliana GN... [more]
HAK25_ORYSJ1.397e-2152.22Potassium transporter 25 OS=Oryza sativa subsp. ja... [more]
POT2_ARATH1.544e-2057.89Potassium transporter 2 OS=Arabidopsis thaliana GN... [more]
POT1_ARATH1.707e-1954.17Potassium transporter 1 OS=Arabidopsis thaliana GN... [more]
POT8_ARATH8.473e-1947.87Potassium transporter 8 OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IaR_C04 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IaR_C04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304865 ID=CB304865|Name=CB304865|organism=Citrus sinensis|type=EST|length=615bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGGGAGAAAGGAAGCTTCTT
TATGAATTACCTGCAACAAGAGTCTATTTAACATACATGCGTTCAGCTTA
CATTCCACCCCAACAGGAAAGACAAGATGCCTCCTTATGCACCCTCTCAA
AATTATGACTGGCATCGACCAAGGATGATAGACCCTTTTTCATTTTTCAT
AATTTATCTAACTAAACATAGTATATCATGCCAACTTCAATGAGGCTAAT
GGGGGGGATGTTTAGTGCAACAGAAGGGCCCCTGCAGTTCTTCCGAAGAA
ATGAATACAAGATATCAATCATAAACCTTTTCACAAATGAGGATGATCTC
CTAGCCTTCACATAGGAGTGACCCATTATGTAAGCAATTCCAGCTTCCTT
GGCCTGGATCAAATCCATCAGCTCTTCCCTCACTACAGGATCCATTCCAG
GATCTGATGGTAACTGAAACCTCACCTGCCGCCTCCTGACTGGATTATCC
TCATCAAAAACAGATTGCAAACTCTGAAGAGTTAAAGATTTGCTGCTCTG
GATGGAGCTGCTCGAACCAATATCCTCTTCTTGTACAGATATTATCAGGT
TCGTGCTTGATCAAC
back to top