CB304878

Overview
NameCB304878
Unique NameCB304878
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length420
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2603 contig Csv1_Contig2603:870..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AAT5_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP5 PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 6.253e-34
Identity = 67/70 (95.71%), Postives = 69/70 (98.57%), Query Frame = -3
Query:  209 KDKSGKDWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS 418
            KDKSGKDWSFI +QIGMFSFTGLNKAQSDNMT+KWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS
Sbjct:  384 KDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS 453          
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AATM_LUPAN (Aspartate aminotransferase P2, mitochondrial (Fragment) OS=Lupinus angustifolius PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.481e-32
Identity = 64/70 (91.43%), Postives = 67/70 (95.71%), Query Frame = -3
Query:  209 KDKSGKDWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS 418
            KDKSGKDWSFI +QIGMFS+TGLNK QSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDS+H VS
Sbjct:  385 KDKSGKDWSFILKQIGMFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHYVS 454          
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AAT3_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP3 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.214e-14
Identity = 36/56 (64.29%), Postives = 43/56 (76.79%), Query Frame = -3
Query:  233 DWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI 400
            DWS I +QIGMF+FTGLN AQ   MT ++H+YMT DGRIS+AGLS     +LADAI
Sbjct:  386 DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAI 441          
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AAT2_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana GN=ASP2 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 5.503e-14
Identity = 35/56 (62.50%), Postives = 44/56 (78.57%), Query Frame = -3
Query:  233 DWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI 400
            DWS I +QIGMF+FTGLNK Q + MT ++H+YMT DGRIS+AGLS     +LADA+
Sbjct:  342 DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAM 397          
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AATC_DAUCA (Aspartate aminotransferase, cytoplasmic OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.387e-14
Identity = 35/56 (62.50%), Postives = 43/56 (76.79%), Query Frame = -3
Query:  233 DWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI 400
            DWS I +QIGMF+FTGLN  Q   MTN++H+Y+T DGRIS+AGLS     +LADAI
Sbjct:  342 DWSHIVKQIGMFTFTGLNSEQVTFMTNEYHIYLTSDGRISMAGLSSRTVPHLADAI 397          
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AATM_DICDI (Aspartate aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=aatA PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.355e-12
Identity = 32/62 (51.61%), Postives = 44/62 (70.97%), Query Frame = -3
Query:  233 KDKSGKDWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI 418
            K  S +DWS I  QIGMF FTGL   Q D + N++H+Y+T++GRIS+AG++    EYLA A+
Sbjct:  358 KHGSTRDWSHITTQIGMFCFTGLTPEQVDRLANEYHIYLTRNGRISIAGINSTNVEYLAKAM 419          
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AATC_ORYSJ (Aspartate aminotransferase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os01g0760600 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.312e-12
Identity = 34/56 (60.71%), Postives = 41/56 (73.21%), Query Frame = -3
Query:  233 DWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI 400
            DWS I +QIGMF+FTGLN  Q   M  ++H+YMT DGRIS+AGLS     +LADAI
Sbjct:  344 DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAI 399          
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AATC_DICDI (Aspartate aminotransferase, cytoplasmic OS=Dictyostelium discoideum GN=aatB PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.151e-12
Identity = 30/59 (50.85%), Postives = 42/59 (71.19%), Query Frame = -3
Query:  224 DWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDS 400
            +W  I  QIGMF++TGL K Q D + NK+H+Y+   GR+SLAGL+    +Y ADAI+D+
Sbjct:  375 NWEHIVNQIGMFTYTGLTKPQVDILVNKYHIYLLGSGRVSLAGLNNKNIDYFADAILDA 433          
BLAST of CB304878 vs. ExPASy Swiss-Prot
Match: AAT1_MEDSA (Aspartate aminotransferase 1 OS=Medicago sativa GN=AAT-1 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 5.151e-12
Identity = 32/56 (57.14%), Postives = 41/56 (73.21%), Query Frame = -3
Query:  233 DWSFIFRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI 400
            DWS I +QIGMF+FTGLN  Q   +T ++H+Y+T DGRIS+AGLS     +LA AI
Sbjct:  355 DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLAHAI 410          
The following BLAST results are available for this feature:
BLAST of CB304878 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
AAT5_ARATH6.253e-3495.71Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AATM_LUPAN4.481e-3291.43Aspartate aminotransferase P2, mitochondrial (Frag... [more]
AAT3_ARATH4.214e-1464.29Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AAT2_ARATH5.503e-1462.50Aspartate aminotransferase, cytoplasmic isozyme 1 ... [more]
AATC_DAUCA9.387e-1462.50Aspartate aminotransferase, cytoplasmic OS=Daucus ... [more]
AATM_DICDI1.355e-1251.61Aspartate aminotransferase, mitochondrial OS=Dicty... [more]
AATC_ORYSJ2.312e-1260.71Aspartate aminotransferase, cytoplasmic OS=Oryza s... [more]
AATC_DICDI5.151e-1250.85Aspartate aminotransferase, cytoplasmic OS=Dictyos... [more]
AAT1_MEDSA5.151e-1257.14Aspartate aminotransferase 1 OS=Medicago sativa GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IaR_D11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IaR_D11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304878 ID=CB304878|Name=CB304878|organism=Citrus sinensis|type=EST|length=420bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCAATTCCAAAAGCTATAT
TAAATCTTCCGGAAATACGTACATATAACACTGCTCAATCAAAACTTGAC
CATTGGAACTTGTAAGCATTGGAGTAAATAATAATCAATTTGGACTCCCC
AACATTTTAATGGTCTGATTTCTAATGTGAATATCTGTCTAGGGGTCCAA
CAACTTCAACTGACATTGTGATATGAATCAATGATGGCATCGGCAAGATA
TTCACATTTGGCCAAAGACAATCCAGCCAAGGATATCCTCCCATCCTTGG
TCATGTAAACATGCCACTTATTTGTCATATTATCACTCTGCGCTTTGTTC
AAGCCTGTGAATGAAAACATGCCAATCTGCCTGAAAATGAATGACCAATC
TTTTCCACTCTTATCTTTTG
back to top