CB304879

Overview
NameCB304879
Unique NameCB304879
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length620
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10990 contig Csv1_Contig10990:1..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304879 vs. ExPASy Swiss-Prot
Match: KTAP2_HUMAN (Keratinocyte-associated protein 2 OS=Homo sapiens GN=KRTCAP2 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.284e-11
Identity = 41/119 (34.45%), Postives = 63/119 (52.94%), Query Frame = -3
Query:  268 GFSKAMAGSGSSMLYSFLMFIVILSLQQMYRGKLASTELFTILGGFISSLLFLVSLTFIGNFQET---SGMKTG-WGXXXXXXXXXXXXASTVHRVCITTCFLFSAGLLYEVNKLSGMM 612
            G    + G+G+S+  S L+ +++ +  QMY  +LASTE  TI GG + S LF+ SLT   N +      G +   +             +  +HRVC+TTCF+FS   LY +NK+S  +
Sbjct:   23 GRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTL 141          
BLAST of CB304879 vs. ExPASy Swiss-Prot
Match: KTAP2_BOVIN (Keratinocyte-associated protein 2 OS=Bos taurus GN=KRTCAP2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.982e-11
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = -3
Query:  268 MAGSGSSMLYSFLMFIVILSLQQMYRGKLASTELFTILGGFISSLLFLVSLTFIGNFQET---SGMKTG-WGXXXXXXXXXXXXASTVHRVCITTCFLFSAGLLYEVNKLSGMM 597
            + G+G+S+  S L+ +++ +  QMY  +LASTE  TI GG + S LF+ SLT   N +      G +   +             +  +HRVC+TTCF+FS   LY +NK+S  +
Sbjct:    2 VVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTL 115          
BLAST of CB304879 vs. ExPASy Swiss-Prot
Match: KTAP2_CANFA (Keratinocyte-associated protein 2 OS=Canis familiaris GN=KRTCAP2 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.895e-11
Identity = 40/112 (35.71%), Postives = 61/112 (54.46%), Query Frame = -3
Query:  268 GSGSSMLYSFLMFIVILSLQQMYRGKLASTELFTILGGFISSLLFLVSLTFIGNFQET---SGMKTG-WGXXXXXXXXXXXXASTVHRVCITTCFLFSAGLLYEVNKLSGMM 591
            G+G+S+  S L+ +++ +  QMY  +LASTE  TI GG + S LF+ SLT   N +      G +   +             +  +HRVC+TTCF+FS   LY +NK+S  +
Sbjct:    4 GTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTL 115          
BLAST of CB304879 vs. ExPASy Swiss-Prot
Match: KTAP2_RAT (Keratinocyte-associated protein 2 OS=Rattus norvegicus GN=Krtcap2 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 8.677e-11
Identity = 39/114 (34.21%), Postives = 62/114 (54.39%), Query Frame = -3
Query:  268 MAGSGSSMLYSFLMFIVILSLQQMYRGKLASTELFTILGGFISSLLFLVSLTFIGNFQET---SGMKTG-WGXXXXXXXXXXXXASTVHRVCITTCFLFSAGLLYEVNKLSGMM 597
            + G+G+S+  S L+ +++ +  Q+Y  +LASTE  TI GG + S LF+ SLT   N +      G +   +             +  +HRVC+TTCF+FS   LY +NK+S  +
Sbjct:    2 VVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTL 115          
BLAST of CB304879 vs. ExPASy Swiss-Prot
Match: KTAP2_MOUSE (Keratinocyte-associated protein 2 OS=Mus musculus GN=Krtcap2 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 8.677e-11
Identity = 39/114 (34.21%), Postives = 62/114 (54.39%), Query Frame = -3
Query:  268 MAGSGSSMLYSFLMFIVILSLQQMYRGKLASTELFTILGGFISSLLFLVSLTFIGNFQET---SGMKTG-WGXXXXXXXXXXXXASTVHRVCITTCFLFSAGLLYEVNKLSGMM 597
            + G+G+S+  S L+ +++ +  Q+Y  +LASTE  TI GG + S LF+ SLT   N +      G +   +             +  +HRVC+TTCF+FS   LY +NK+S  +
Sbjct:    2 VVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTL 115          
The following BLAST results are available for this feature:
BLAST of CB304879 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
KTAP2_HUMAN2.284e-1134.45Keratinocyte-associated protein 2 OS=Homo sapiens ... [more]
KTAP2_BOVIN2.982e-1135.09Keratinocyte-associated protein 2 OS=Bos taurus GN... [more]
KTAP2_CANFA3.895e-1135.71Keratinocyte-associated protein 2 OS=Canis familia... [more]
KTAP2_RAT8.677e-1134.21Keratinocyte-associated protein 2 OS=Rattus norveg... [more]
KTAP2_MOUSE8.677e-1134.21Keratinocyte-associated protein 2 OS=Mus musculus ... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IaR_D12 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IaR_D12 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304879 ID=CB304879|Name=CB304879|organism=Citrus sinensis|type=EST|length=620bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCGAGAACAAAAAGGACTAT
CTTGCCGATAAAAGGCATTGTAAATATGTTGGACACAAAAATGTATCAAA
CAGACAATCACTGTCAGACAAACTATAAAGTATCAGTAATTTTTCGTTTT
TGATAGTTATCCGCTACACTCAAAAATGATTATGGATACAAAGATAAGAT
GATAAAACCTCCTGTAATTTATCCGGCATCATCAATGCCTTTTTGTTTTG
GATTCACTTCTGGCAATCATCATCCCTGAAAGCTTGTTGACCTCGTACAG
CAGTCCAGCTGAGAACAAGAAACATGTTGTAATGCAGACTCGATGAACAG
TGCTAGCGGCAATCAGAGCAATCAGTTCCGCCACTATAACAGCACCCCAT
CCAGTCTTCATACCACTTGTTTCCTGAAAATTTCCAATGAACGTCAGTGA
CACAAGGAATAGGAGTGAGCTGATGAAGCCTCCAAGAATCGTAAACAACT
CCGTTGATGCCAGCTTCCCTCTATACATTTGTTGAAGAGAGAGGATGACA
ATAAACATAAGAAATGAATAGAGCATCGAACTCCCAGACCCAGCCATGGC
CTTTGAAAAACCCTAGCCCC
back to top