CB304883

Overview
NameCB304883
Unique NameCB304883
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length515
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304883_ssr156 microsatellite CB304883_ssr156:156..167. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2668 contig Csv1_Contig2668:271..784. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 6.363e-34
Identity = 66/98 (67.35%), Postives = 79/98 (80.61%), Query Frame = -3
Query:  220 APVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 513
            AP T A++CGQV+ SLAPCI++L  GG  PP  CC+GV+SLN AA+TTPDRQAAC CLK AY SI G+NA  AA  P +CGVSIPYKISP+TDCS+V+
Sbjct:   20 APYTEALSCGQVSSSLAPCISYLTKGGAVPPA-CCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 9.188e-33
Identity = 65/92 (70.65%), Postives = 75/92 (81.52%), Query Frame = -3
Query:  220 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 495
            ITCGQV+ SLAPCI +LR GG   P  CCNGVRSLN AA+TT DRQAACNCLK A+ SI G+N N+AAGLP +CGVS+PYKISP+TDC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGG-VVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.200e-32
Identity = 61/97 (62.89%), Postives = 78/97 (80.41%), Query Frame = -3
Query:  220 PVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 510
            P+  AITCGQV+ +LAPCI ++R GG  PP  CCNG+R++N  ARTTPDRQAACNCLKQ   S+PG+N N AA LP +CGV+IPY+ISP+T+C+ V+
Sbjct:   22 PIAQAITCGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.491e-32
Identity = 59/97 (60.82%), Postives = 78/97 (80.41%), Query Frame = -3
Query:  220 PVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 510
            P+  A+TCGQV+ +LAPCIA++R GG  PP  CCNG+R++N  A+TT DRQ ACNCLKQ   S+PG+NAN AA LP +CGV++PYKISP+T+C+ V+
Sbjct:   22 PIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.956e-31
Identity = 61/96 (63.54%), Postives = 76/96 (79.17%), Query Frame = -3
Query:  220 VTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 507
            V +AITCGQVT SLAPCI ++R+GG  PP  CCNG+R++NG ARTT DRQ ACNCLK    SI G+N N AAGLP +CGV++PYKIS +T+C+ V+
Sbjct:   21 VAHAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUPE (Non-specific lipid-transfer protein 1 OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.268e-30
Identity = 59/92 (64.13%), Postives = 73/92 (79.35%), Query Frame = -3
Query:  220 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 495
            ITCGQV+ +LAPCI ++R GG  PP  CCNG+R++N  ARTTPDRQAACNCLKQ   S+PG+N N AA LP +CGV IPYKIS +T+C+ V+
Sbjct:    1 ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 4.719e-29
Identity = 58/92 (63.04%), Postives = 72/92 (78.26%), Query Frame = -3
Query:  220 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 495
            ITCGQV+ SLAPCI ++R GG  PP  CCNG+R++N  ARTTPDR+ ACNCLKQ   SI G+N N AA LP +CGV+IPYKIS +T+C+ V+
Sbjct:    1 ITCGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP_DAUCA (Non-specific lipid-transfer protein OS=Daucus carota GN=EP2 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.793e-28
Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = -3
Query:  223 ITCGQVTGSLAPCIAFLRTGGRFPPP-PCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRV 495
            +TCGQVTG+LAPC+ +LR+    P P  CCN VR LN AARTT D++ AC CLKQ   ++ G+N N AAGLP +CGV+IPYKISP TDC+RV
Sbjct:   28 LTCGQVTGALAPCLGYLRSQVNVPVPLTCCNVVRGLNNAARTTLDKRTACGCLKQTANAVTGLNLNAAAGLPARCGVNIPYKISPTTDCNRV 119          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.793e-28
Identity = 61/98 (62.24%), Postives = 72/98 (73.47%), Query Frame = -3
Query:  220 APVTNAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 513
            AP   AITCGQVT +LAPC+A+LR  G  P   CC GV++L  +ARTT DRQ AC CLK A  +I GIN   AAGLP  CGV+IPYKISP+TDCS+V+
Sbjct:   19 APCAEAITCGQVTSNLAPCLAYLRNTG--PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ 114          
BLAST of CB304883 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDO (Non-specific lipid-transfer protein 1 OS=Prunus domestica PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.793e-28
Identity = 56/92 (60.87%), Postives = 73/92 (79.35%), Query Frame = -3
Query:  220 ITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRSIPGINANVAAGLPRQCGVSIPYKISPNTDCSRVR 495
            ITCGQV+ +LAPCI +++ GG  PP  CCNG+R++N  ARTT DR+AACNCLKQ   SIPG+N N AA LP +CGV++PYKIS +T+C+ V+
Sbjct:    1 ITCGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK 91          
The following BLAST results are available for this feature:
BLAST of CB304883 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 81
Match NameE-valueIdentityDescription
NLTP_HELAN6.363e-3467.35Non-specific lipid-transfer protein OS=Helianthus ... [more]
LTP1_MORNI9.188e-3370.65Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP1_PRUDU1.200e-3262.89Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_PRUAV3.491e-3260.82Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP_MALDO2.956e-3163.54Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP1_PRUPE3.268e-3064.13Non-specific lipid-transfer protein 1 OS=Prunus pe... [more]
NLTP1_PRUAR4.719e-2963.04Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]
NLTP_DAUCA1.793e-2861.96Non-specific lipid-transfer protein OS=Daucus caro... [more]
NLTP1_TOBAC1.793e-2862.24Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]
NLTP1_PRUDO1.793e-2860.87Non-specific lipid-transfer protein 1 OS=Prunus do... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IaR_E05 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IaR_E05 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304883 ID=CB304883|Name=CB304883|organism=Citrus sinensis|type=EST|length=515bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTTCAAAACACAGATCACGT
TTACATATTTAATATGATATTAAAAGCAAAGATACAAACATGACATGAGA
GTGAGACTCACACAAGTGGAGACTCGTTCGGACAAAGAAATTAACATATA
TATTCTTTATTTATTTATTCTTCTCAGTCAATCATACTTGGAAAGTCACA
GAGCTCTAACTCAACTTCACCTGACCCTAGAGCAGTCAGTGTTGGGGCTG
ATCTTGTAAGGAATGCTGACTCCACATTGACGAGGAAGGCCAGCGGCAAC
ATTAGCGTTGATGCCGGGGATTGATCGGTAAGCTTGCTTCAAGCAGTTGC
ATGCAGCTTGGCGGTCAGGGGTGGTTCTGGCGGCGCCGTTGAGAGACCTG
ACGCCGTTACAGCATGGGGGTGGAGGAAAACGCCCTCCAGTTCTCAAGAA
AGCGATGCATGGAGCCAAGGAGCCTGTCACCTGCCCACATGTTATGGCAT
TAGTCACTGGGGCAG
back to top