CB304894

Overview
NameCB304894
Unique NameCB304894
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length618
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1621 contig Csv1_Contig1621:592..1209. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP2_ARATH (Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 2.364e-85
Identity = 148/194 (76.29%), Postives = 173/194 (89.18%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            LN+ PL  K IR+MYSHRDPS+R+SG GNIFIKNLD+SIDHKALHDTFS FGNI+SCK+A D SGQSKG+GFVQ+ N+ESAQ AI+KLNGML+NDKQV+VG FLR+QER++ A KTKF NV+VKNL ESTTD+DLK  FGEYG ITSAVVM+DG+GKSK FGFVNFEN DDAA+AV++LNG KFDD+EWYVG+A
Sbjct:   97 LNYIPLYGKPIRVMYSHRDPSVRRSGAGNIFIKNLDESIDHKALHDTFSSFGNIVSCKVAVDSSGQSKGYGFVQYANEESAQKAIEKLNGMLLNDKQVYVGPFLRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRA 290          

HSP 2 Score: 147.132 bits (370), Expect = 6.528e-35
Identity = 83/210 (39.52%), Postives = 120/210 (57.14%), Query Frame = -2
Query:   33 LNFTPLNNKSIRI----MYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERET------------VAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            LN   LN+K + +        RD +  K+   N+++KNL +S     L + F  +G I S  +  DG G+SKGFGFV FEN + A  A++ LNG   +DK+ +VG   +K ERET             A K + +N++VKNLD S +DE LK+IF  +GT+TS+ VMRD +G SK  GFV F   ++A +A+  L+GK  + +  YV  A
Sbjct:  184 LNGMLLNDKQVYVGPFLRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQKKSERETELRVRYEQNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIA 393          

HSP 3 Score: 77.411 bits (189), Expect = 6.352e-14
Identity = 39/98 (39.80%), Postives = 60/98 (61.22%), Query Frame = -2
Query:  252 KSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNV 545
            K  + N+++KNLD SI  + L + FSPFG + S K+  D +G SKG GFV F   E A  A+ +L+G +I  K ++V    RK++R  V ++ +F+ V
Sbjct:  314 KFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIAQRKEDRR-VRLQAQFSQV 410          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP3_ARATH (Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.947e-63
Identity = 122/196 (62.24%), Postives = 152/196 (77.55%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQE--RETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            LN+TPL ++ IRIM S+RDPS R SG GNIFIKNLD SID+KAL +TFS FG ILSCK+A D +G+SKG+GFVQFE +ESAQ AIDKLNGML+NDKQVFVGHF+R+QE  R+      +F NV+VKNL +   +++L+K FG++G I+SAVVMRD  G S+CFGFVNFE  + AA AV+ +NG    D   YVG+A
Sbjct:  109 LNYTPLFDRPIRIMLSNRDPSTRLSGKGNIFIKNLDASIDNKALFETFSSFGTILSCKVAMDVTGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIRRQERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFECTEAAASAVEKMNGISLGDDVLYVGRA 304          

HSP 2 Score: 132.494 bits (332), Expect = 1.664e-30
Identity = 74/197 (37.56%), Postives = 110/197 (55.84%), Query Frame = -2
Query:   33 IRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFN-------------NVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 584
            IR     RD +       N+++KNL K I    L  TF  FG I S  +  D SG S+ FGFV FE  E+A +A++K+NG+ + D  ++VG   +K ERE   ++ KF              N+++KNLD+S  DE LK++F EYG +TS+ VM +  G S+ FGFV + N ++A +A+  +NGK    +  Y+  A
Sbjct:  212 IRRQERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFECTEAAASAVEKMNGISLGDDVLYVGRAQKKSEREE-ELRRKFEQERINRFEKSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALA 407          

HSP 3 Score: 77.411 bits (189), Expect = 6.352e-14
Identity = 34/86 (39.53%), Postives = 55/86 (63.95%), Query Frame = -2
Query:  288 KSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQER 545
            KS   N+++KNLD S+D + L + FS +GN+ S K+  +  G S+GFGFV + N E A  A+ ++NG +I  K +++    RK++R
Sbjct:  328 KSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALAQRKEDR 413          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP5_ARATH (Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 1.396e-61
Identity = 119/197 (60.41%), Postives = 154/197 (78.17%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQER---ETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            LN+ P+ ++ IRIM S+RDPS R SG GN+FIKNLD SID+KAL++TFS FG ILSCK+A D  G+SKG+GFVQFE +E+AQ AIDKLNGML+NDKQVFVGHF+R+Q+R   E+ A+ + F NV+VKNL +  TD++LKK FG+YG I+SAVVM+D  G S+ FGFVNF + + AA AV+ +NG    +   YVG+A
Sbjct:  105 LNYAPIRDRPIRIMLSNRDPSTRLSGKGNVFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFVGHFVRRQDRARSESGAVPS-FTNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRA 300          

HSP 2 Score: 130.183 bits (326), Expect = 8.258e-30
Identity = 75/213 (35.21%), Postives = 118/213 (55.40%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTG------NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKF-------------NNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            LN   LN+K + + +  R     +S +G      N+++KNL K I    L  TF  +G+I S  +  D SG S+ FGFV F + E+A  A++K+NG+ + +  ++VG   +K +RE   ++ KF             +N+++KNLD+S  DE LK++F EYG +TS  VM +  G S+ FGFV + N ++A  A+  +NGK    +  YV  A
Sbjct:  192 LNGMLLNDKQVFVGHFVRRQDRARSESGAVPSFTNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQKKSDREE-ELRRKFEQERISRFEKLQGSNLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALA 403          

HSP 3 Score: 77.7962 bits (190), Expect = 4.864e-14
Identity = 34/82 (41.46%), Postives = 55/82 (67.07%), Query Frame = -2
Query:  285 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERE 530
            N+++KNLD S++ + L + FS +GN+ SCK+  +  G S+GFGFV + N E A  A+ ++NG +I  K ++V    RK+ER+
Sbjct:  329 NLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALAQRKEERQ 410          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP_COCIM (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis GN=PAB1 PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.228e-59
Identity = 110/197 (55.84%), Postives = 152/197 (77.16%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERET--VAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGD-GKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            LN+T +  +  RIM+S RDP++RK+G GN+FIKNLD +ID+KALHDTF+ FGNILSCK+A D  G SKG+GFV +E  E+AQNAI  +NGML+NDK+VFVGH + K++R++    +K  F NV+VKN+D+ TT+E+ + +F ++G ITSA + RD + GKS+ FGFVNF + D+AA AV+ALN K F  ++ YVG+A
Sbjct:  116 LNYTLIKGRPCRIMWSQRDPALRKTGQGNVFIKNLDTAIDNKALHDTFAAFGNILSCKVAQDEFGNSKGYGFVHYETAEAAQNAIKHVNGMLLNDKKVFVGHHIAKKDRQSKFEEMKANFTNVYVKNIDQDTTEEEFRDLFEKFGEITSATLARDAESGKSRGFGFVNFTSHDNAAAAVEALNDKDFKGQKLYVGRA 312          

HSP 2 Score: 104.375 bits (259), Expect = 4.852e-22
Identity = 73/237 (30.80%), Postives = 107/237 (45.15%), Query Frame = -2
Query:   33 KSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDG-SGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETV------------AIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRD-------------------------------GD----------------------GKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 545
            K+   N+++KN+D+    +   D F  FG I S  +A D  SG+S+GFGFV F + ++A  A++ LN      ++++VG   +K ERE              A K +  N+++KNL +   DE L+++F  YGTITSA VMRD                               GD                      GKSK FGFV F + D+A+KAV  +N +    +  YV  A
Sbjct:  232 KANFTNVYVKNIDQDTTEEEFRDLFEKFGEITSATLARDAESGKSRGFGFVNFTSHDNAAAAVEALNDKDFKGQKLYVGRAQKKHEREEELRKQYEAARIEKASKYQGVNLYIKNLSDDIDDEKLRELFSSYGTITSAKVMRDFAPESTSDSEKEAKKDSKEPETKEEEPKDEAGDNAENKDNKENKAESKKSEKKPLGKSKGFGFVCFSSPDEASKAVTEMNQRMVHGKPLYVALA 468          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP1_RAT (Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.910e-59
Identity = 113/196 (57.65%), Postives = 148/196 (75.51%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETV--AIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            +NF  +  K +RIM+S RDPS+RKSG GNIFIKNLDKSID+KAL+DTFS FGNILSCK+  D +G SKG+GFV FE +E+A+ AI+K+NGML+ND++VFVG F  ++ERE    A   +F NV++KN  E   DE LK++FG++G   S  VM D  GKSK FGFV+FE  +DA KAVD +NGK+ + ++ YVG+A
Sbjct:   72 MNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRA 266          

HSP 2 Score: 146.747 bits (369), Expect = 8.526e-35
Identity = 81/179 (45.25%), Postives = 111/179 (62.01%), Query Frame = -2
Query:   33 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFN-------------NVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 530
            N++IKN  + +D + L + F  FG  LS K+ TD SG+SKGFGFV FE  E AQ A+D++NG  +N KQ++VG   +K ER+T  +K KF              N++VKNLD+   DE L+K F  +GTITSA VM +G G+SK FGFV F + ++A KAV  +NG+    +  YV  A
Sbjct:  192 NVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQT-ELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEG-GRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA 368          

HSP 3 Score: 94.3597 bits (233), Expect = 5.021e-19
Identity = 55/176 (31.25%), Postives = 98/176 (55.68%), Query Frame = -2
Query:   36 DPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDG-SGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGK 560
            +PS       ++++ +L   +    L++ FSP G ILS ++  D  + +S G+ +V F+    A+ A+D +N  +I  K V +       +R+    K+   N+F+KNLD+S  ++ L   F  +G I S  V+ D +G SK +GFV+FE  + A +A++ +NG   +DR+ +VG+
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRI----MWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGR 172          

HSP 4 Score: 77.411 bits (189), Expect = 6.352e-14
Identity = 37/82 (45.12%), Postives = 54/82 (65.85%), Query Frame = -2
Query:  285 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERE 530
            N+++KNLD  ID + L   FSPFG I S K+  +G G+SKGFGFV F + E A  A+ ++NG ++  K ++V    RK+ER+
Sbjct:  295 NLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEG-GRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ 375          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP_NEOFI (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 3.800e-59
Identity = 107/196 (54.59%), Postives = 147/196 (75.00%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERET--VAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            LN+T +  K  RIM+S RDP++RK+G GN+FIKNLD +ID+KALHDTF+ FGNILSCK+A D  G SKG+GFV +E  E+A NAI  +NGML+NDK+VFVGH + K++R++    +K  F NV++KN+D+  TDE+ +K+F ++G ITSA + RD +GKS+ FGFVNF   D A  AVD +N K+   ++ YVG+A
Sbjct:  113 LNYTLIKGKPCRIMWSQRDPALRKTGQGNVFIKNLDAAIDNKALHDTFAAFGNILSCKVAQDEFGNSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDRQSKFEEMKANFTNVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQEGKSRGFGFVNFSTHDSAQAAVDEMNDKEIKGQKLYVGRA 308          

HSP 2 Score: 112.079 bits (279), Expect = 2.327e-24
Identity = 73/228 (32.02%), Postives = 109/228 (47.81%), Query Frame = -2
Query:   33 KSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERE------------TVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRD----GD-----------------------------------------GKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 545
            K+   N++IKN+D+ +  +     F  FG I S  ++ D  G+S+GFGFV F   +SAQ A+D++N   I  ++++VG   +K ERE              A K +  N++VKNL +   DE L+++F  +GTITSA VMRD    G+                                         GKSK FGFV F + D+A+KAV  +N +  + +  YV  A
Sbjct:  229 KANFTNVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQEGKSRGFGFVNFSTHDSAQAAVDEMNDKEIKGQKLYVGRAQKKHEREEELRKQYEAARLEKASKYQGVNLYVKNLTDDVDDEKLRELFSPFGTITSAKVMRDTVTAGETSESEKEKESNKENEKEGEEKTEEKPKESEEEAKKTEKKILGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALA 456          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP_ASPFU (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus fumigatus GN=pab1 PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 3.800e-59
Identity = 107/196 (54.59%), Postives = 147/196 (75.00%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERET--VAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            LN+T +  K  RIM+S RDP++RK+G GN+FIKNLD +ID+KALHDTF+ FGNILSCK+A D  G SKG+GFV +E  E+A NAI  +NGML+NDK+VFVGH + K++R++    +K  F NV++KN+D+  TDE+ +K+F ++G ITSA + RD +GKS+ FGFVNF   D A  AVD +N K+   ++ YVG+A
Sbjct:  113 LNYTLIKGKPCRIMWSQRDPALRKTGQGNVFIKNLDAAIDNKALHDTFAAFGNILSCKVAQDEFGNSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDRQSKFEEMKANFTNVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQEGKSRGFGFVNFSTHDSAQAAVDEMNDKEIKGQKLYVGRA 308          

HSP 2 Score: 111.309 bits (277), Expect = 3.969e-24
Identity = 73/230 (31.74%), Postives = 109/230 (47.39%), Query Frame = -2
Query:   33 KSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERE------------TVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRD----GD-------------------------------------------GKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 545
            K+   N++IKN+D+ +  +     F  FG I S  ++ D  G+S+GFGFV F   +SAQ A+D++N   I  ++++VG   +K ERE              A K +  N++VKNL +   DE L+++F  +GTITSA VMRD    G+                                           GKSK FGFV F + D+A+KAV  +N +  + +  YV  A
Sbjct:  229 KANFTNVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQEGKSRGFGFVNFSTHDSAQAAVDEMNDKEIKGQKLYVGRAQKKHEREEELRKQYEAARLEKASKYQGVNLYVKNLTDDVDDEKLRELFSPFGTITSAKVMRDTVTTGETSESEKEKEKESNKENEKEGEEKTEEKPKESEEEPKKTEKKILGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVALA 458          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP1_MOUSE (Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 3.800e-59
Identity = 113/196 (57.65%), Postives = 148/196 (75.51%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETV--AIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            +NF  +  K +RIM+S RDPS+RKSG GNIFIKNLDKSID+KAL+DTFS FGNILSCK+  D +G SKG+GFV FE +E+A+ AI+K+NGML+ND++VFVG F  ++ERE    A   +F NV++KN  E   DE LK++FG++G   S  VM D  GKSK FGFV+FE  +DA KAVD +NGK+ + ++ YVG+A
Sbjct:   72 MNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSQKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRA 266          

HSP 2 Score: 146.747 bits (369), Expect = 8.526e-35
Identity = 81/179 (45.25%), Postives = 111/179 (62.01%), Query Frame = -2
Query:   33 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFN-------------NVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 530
            N++IKN  + +D + L + F  FG  LS K+ TD SG+SKGFGFV FE  E AQ A+D++NG  +N KQ++VG   +K ER+T  +K KF              N++VKNLD+   DE L+K F  +GTITSA VM +G G+SK FGFV F + ++A KAV  +NG+    +  YV  A
Sbjct:  192 NVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQT-ELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEG-GRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA 368          

HSP 3 Score: 94.3597 bits (233), Expect = 5.021e-19
Identity = 55/176 (31.25%), Postives = 98/176 (55.68%), Query Frame = -2
Query:   36 DPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDG-SGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGK 560
            +PS       ++++ +L   +    L++ FSP G ILS ++  D  + +S G+ +V F+    A+ A+D +N  +I  K V +       +R+    K+   N+F+KNLD+S  ++ L   F  +G I S  V+ D +G SK +GFV+FE  + A +A++ +NG   +DR+ +VG+
Sbjct:    2 NPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRI----MWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGR 172          

HSP 4 Score: 77.411 bits (189), Expect = 6.352e-14
Identity = 37/82 (45.12%), Postives = 54/82 (65.85%), Query Frame = -2
Query:  285 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERE 530
            N+++KNLD  ID + L   FSPFG I S K+  +G G+SKGFGFV F + E A  A+ ++NG ++  K ++V    RK+ER+
Sbjct:  295 NLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEG-GRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ 375          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABPA_XENLA (Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-A PE=1 SV=3)

HSP 1 Score: 227.254 bits (578), Expect = 4.963e-59
Identity = 112/196 (57.14%), Postives = 147/196 (75.00%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETV--AIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            +NF  +  + +RIM+S RDPS+RKSG GNIFIKNLDKSID+KAL+DTFS FGNILSCK+  D +G SKG+GFV FE +E+A+ AIDK+NGML+ND++VFVG F  ++ERE    A   +F NV++KN  +   DE LK++FG+YG   S  VM D +GKSK FGFV+FE  +DA KAVD +NGK  + +  +VG+A
Sbjct:   72 MNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGDDMNDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDEMNGKDMNGKSMFVGRA 266          

HSP 2 Score: 138.272 bits (347), Expect = 3.032e-32
Identity = 78/179 (43.58%), Postives = 109/179 (60.89%), Query Frame = -2
Query:   33 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFN-------------NVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 530
            N++IKN    ++ + L + F  +G  LS K+ TD +G+SKGFGFV FE  E AQ A+D++NG  +N K +FVG   +K ER+T  +K KF              N++VKNLD+   DE L+K F  +GTITSA VM +G G+SK FGFV F + ++A KAV  +NG+    +  YV  A
Sbjct:  192 NVYIKNFGDDMNDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDEMNGKDMNGKSMFVGRAQKKVERQT-ELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFLPFGTITSAKVMMEG-GRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA 368          

HSP 3 Score: 95.5153 bits (236), Expect = 2.254e-19
Identity = 55/176 (31.25%), Postives = 99/176 (56.25%), Query Frame = -2
Query:   36 DPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDG-SGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGK 560
            +PS       ++++ +L + +    L++ FSP G ILS ++  D  + +S G+ +V F+    A+ A+D +N  +I  + V +       +R+    K+   N+F+KNLD+S  ++ L   F  +G I S  V+ D +G SK +GFV+FE  + A +A+D +NG   +DR+ +VG+
Sbjct:    2 NPSAPSYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRI----MWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGR 172          

HSP 4 Score: 75.0998 bits (183), Expect = 3.152e-13
Identity = 36/82 (43.90%), Postives = 53/82 (64.63%), Query Frame = -2
Query:  285 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERE 530
            N+++KNLD  ID + L   F PFG I S K+  +G G+SKGFGFV F + E A  A+ ++NG ++  K ++V    RK+ER+
Sbjct:  295 NLYVKNLDDGIDDERLRKEFLPFGTITSAKVMMEG-GRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ 375          
BLAST of CB304894 vs. ExPASy Swiss-Prot
Match: PABP1_PONAB (Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 4.963e-59
Identity = 113/196 (57.65%), Postives = 147/196 (75.00%), Query Frame = -2
Query:   33 LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETV--AIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 614
            +NF  +  K +RIM+S RDPS+RKSG GNIFIKNLDKSID+KAL+DTFS FGNILSCK+  D +G SKG+GFV FE +E+A+ AI+K+NGML+ND++VFVG F  ++ERE    A   +F NV++KN  E   DE LK +FG++G   S  VM D  GKSK FGFV+FE  +DA KAVD +NGK+ + ++ YVG+A
Sbjct:   72 MNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRA 266          

HSP 2 Score: 148.288 bits (373), Expect = 2.930e-35
Identity = 82/179 (45.81%), Postives = 111/179 (62.01%), Query Frame = -2
Query:   33 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFN-------------NVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGKA 530
            N++IKN  + +D + L D F  FG  LS K+ TD SG+SKGFGFV FE  E AQ A+D++NG  +N KQ++VG   +K ER+T  +K KF              N++VKNLD+   DE L+K F  +GTITSA VM +G G+SK FGFV F + ++A KAV  +NG+    +  YV  A
Sbjct:  192 NVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQT-ELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEG-GRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALA 368          

HSP 3 Score: 92.8189 bits (229), Expect = 1.461e-18
Identity = 55/176 (31.25%), Postives = 97/176 (55.11%), Query Frame = -2
Query:   36 DPSIRKSGTGNIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDG-SGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENVDDAAKAVDALNGKKFDDREWYVGK 560
            +PS       ++++ +L        L++ FSP G ILS ++  D  + +S G+ +V F+    A+ A+D +N  +I  K V +       +R+    K+   N+F+KNLD+S  ++ L   F  +G I S  V+ D +G SK +GFV+FE  + A +A++ +NG   +DR+ +VG+
Sbjct:    2 NPSAPSYPMASLYVGDLHPDATEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRI----MWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGR 172          

HSP 4 Score: 77.411 bits (189), Expect = 6.352e-14
Identity = 37/82 (45.12%), Postives = 54/82 (65.85%), Query Frame = -2
Query:  285 NIFIKNLDKSIDHKALHDTFSPFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERE 530
            N+++KNLD  ID + L   FSPFG I S K+  +G G+SKGFGFV F + E A  A+ ++NG ++  K ++V    RK+ER+
Sbjct:  295 NLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEG-GRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ 375          
The following BLAST results are available for this feature:
BLAST of CB304894 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 157
Match NameE-valueIdentityDescription
PABP2_ARATH2.364e-8576.29Polyadenylate-binding protein 2 OS=Arabidopsis tha... [more]
PABP3_ARATH1.947e-6362.24Polyadenylate-binding protein 3 OS=Arabidopsis tha... [more]
PABP5_ARATH1.396e-6160.41Polyadenylate-binding protein 5 OS=Arabidopsis tha... [more]
PABP_COCIM2.228e-5955.84Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP1_RAT2.910e-5957.65Polyadenylate-binding protein 1 OS=Rattus norvegic... [more]
PABP_NEOFI3.800e-5954.59Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_ASPFU3.800e-5954.59Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP1_MOUSE3.800e-5957.65Polyadenylate-binding protein 1 OS=Mus musculus GN... [more]
PABPA_XENLA4.963e-5957.14Polyadenylate-binding protein 1-A OS=Xenopus laevi... [more]
PABP1_PONAB4.963e-5957.65Polyadenylate-binding protein 1 OS=Pongo abelii GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IaR_F11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IaR_F11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304894 ID=CB304894|Name=CB304894|organism=Citrus sinensis|type=EST|length=618bp
TTTTTTTTTTTTTTTTTTTNNTTTTTTTTTGGGGCTTTTCCAACGTACCA
TTCTCTGTCATCAAATTTCTTTCCATTAAGAGCATCGACAGCTTTGGCAG
CATCATCTACATTTTCAAAATTCACAAATCCAAAACACTTGGATTTTCCA
TCTCCATCCCTCATCACTACTGCACTGGTAATTGTTCCATACTCACCAAA
AATTTTCTTCAAATCTTCATCTGTAGTTGACTCATCAAGGTTTTTGACAA
ATACGTTATTGAATTTTGTTTTAATTGCTACAGTTTCTCTTTCCTGCTTA
CGAAGAAAGTGCCCAACGAACACTTGTTTATCATTAATAAGCATGCCATT
TAACTTATCAATAGCATTTTGAGCAGATTCTTTGTTCTCAAATTGCACAA
AACCGAAACCTTTGGACTGGCCAGAACCATCAGTAGCTATCTTACAAGAA
AGAATGTTTCCGAATGGAGAAAATGTATCGTGTAATGCTTTGTGATCAAT
AGACTTGTCCAAATTCTTGATAAATATGTTCCCAGTACCGCTTTTCCGAA
TACTAGGATCCCGATGGGAATACATGATTCTAATGGACTTATTATTAAGT
GGAGTGAAGTTAAGAACA
back to top