CB304900

Overview
NameCB304900
Unique NameCB304900
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length589
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5856 contig Csv1_Contig5856:537..1125. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304900 vs. ExPASy Swiss-Prot
Match: VP371_ARATH (Vacuolar protein-sorting-associated protein 37 homolog 1 OS=Arabidopsis thaliana GN=VPS37-1 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.287e-45
Identity = 88/125 (70.40%), Postives = 110/125 (88.00%), Query Frame = -2
Query:  202 QNNIRDELHRETLQIARDNLDKELRMIELRNQSKIIRTTELAAAQEKLHDLERQKEQLLKLYSPASLLKRIQEAMNKTEEESENLHRQLLDRELDVGAFVQKYKKLRTTYHRRALIHLSAKTHSV 576
            QNNI+DEL RETLQ+ARDNL+KE +++ELRNQ +IIRTTELA AQEKL++LERQKE++LK YSP SLL ++QEAMN+ +EESE L  + L++E+D  AFVQKYKKLRTTYHRRALIHL+AKT ++
Sbjct:   93 QNNIKDELRRETLQLARDNLEKEPQIMELRNQCRIIRTTELATAQEKLNELERQKEEILKFYSPGSLLHKLQEAMNQVDEESEALQEKFLEKEIDTAAFVQKYKKLRTTYHRRALIHLAAKTSNI 217          
BLAST of CB304900 vs. ExPASy Swiss-Prot
Match: VP372_ARATH (Vacuolar protein-sorting-associated protein 37 homolog 2 OS=Arabidopsis thaliana GN=VPS37-2 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 6.609e-42
Identity = 79/125 (63.20%), Postives = 108/125 (86.40%), Query Frame = -2
Query:  202 QNNIRDELHRETLQIARDNLDKELRMIELRNQSKIIRTTELAAAQEKLHDLERQKEQLLKLYSPASLLKRIQEAMNKTEEESENLHRQLLDRELDVGAFVQKYKKLRTTYHRRALIHLSAKTHSV 576
            QNNIR+EL +ETL +AR+NL+KE +++ELRNQ +IIRT+ELA AQEKL++LE Q+E++LK YSP SLL R+Q+AMN+ +EESE L ++ +++++D  AFVQKYKKLR+ YHRRALIHL+AKT S+
Sbjct:   93 QNNIREELRKETLHLARENLEKEPQIVELRNQCRIIRTSELATAQEKLNELENQREEILKFYSPGSLLHRLQDAMNQVDEESEELQQKFMEKDIDTAAFVQKYKKLRSKYHRRALIHLAAKTSSI 217          
The following BLAST results are available for this feature:
BLAST of CB304900 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
VP371_ARATH1.287e-4570.40Vacuolar protein-sorting-associated protein 37 hom... [more]
VP372_ARATH6.609e-4263.20Vacuolar protein-sorting-associated protein 37 hom... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IaR_G06 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IaR_G06 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304900 ID=CB304900|Name=CB304900|organism=Citrus sinensis|type=EST|length=589bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTGAAACAACTATTTCAGAAT
AGAATTCATTTCAAGATAAAATATCATGCCAAATTGAACAAAACCAGAGT
CCATTAGGAATTTATTTACAAACCAAAGACAAATAAAAATAAAAAGGTAT
TATATAAAAAATATATCATGGTATACATTTATTTCAGGCCTTCCCCGCGT
CAACCGAGTGTGTCTTGGCTGAAAGATGAATGAGTGCTCGGCGGTGGTAA
GTTGTGCGCAGCTTCTTGTACTTCTGCACAAAAGCCCCAACATCCAACTC
CCTATCAAGGAGCTGCCTATGCAGGTTTTCAGATTCCTCCTCGGTCTTAT
TCATAGCTTCTTGAATCCTTTTGAGAAGGGAGGCAGGAGAGTACAACTTC
AAAAGTTGTTCTTTCTGTCTCTCAAGATCGTGTAATTTCTCCTGAGCAGC
AGCCAATTCTGTTGTCCGAATAATTTTACTTTGGTTTCTAAGCTCAATCA
TGCGCAGTTCCTTGTCCAAGTTGTCCCTGGCAATTTGCAAAGTTTCCCTG
TGAAGTTCATCCCTTATATTGTTTTGATTTTACTTGATC
back to top