CB304901

Overview
NameCB304901
Unique NameCB304901
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12693 contig Csv1_Contig12693:279..880. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL321_ARATH (60S ribosomal protein L32-1 OS=Arabidopsis thaliana GN=RPL32A PE=2 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 6.687e-45
Identity = 87/97 (89.69%), Postives = 92/97 (94.85%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            KGIDSRVRRKFK   LMPN+GYGSDKKTRHYLPNGFKKFVVHN +ELELLMMHNRTYCAEIAHNVSTKKRK IVERA+QLDVVVTN+LARLRSQE+E
Sbjct:   37 KGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLMMHNRTYCAEIAHNVSTKKRKAIVERASQLDVVVTNRLARLRSQEDE 133          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL322_ARATH (60S ribosomal protein L32-2 OS=Arabidopsis thaliana GN=RPL32B PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 4.334e-44
Identity = 84/97 (86.60%), Postives = 91/97 (93.81%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            KGIDSRVRRKFK   LMPN+GYGSDKKTRHYLPNGFKKF+VHN +ELELLMMHNRTYCAEIAHN+STKKRK IVERA+QLDVVV+NKL RLRSQE+E
Sbjct:   37 KGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFIVHNTSELELLMMHNRTYCAEIAHNISTKKRKAIVERASQLDVVVSNKLGRLRSQEDE 133          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL32_SPOFR (60S ribosomal protein L32 OS=Spodoptera frugiperda GN=RpL32 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.803e-35
Identity = 72/97 (74.23%), Postives = 81/97 (83.51%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            +GID+RVRR+FK   LMPNIGYGS+KKTRH LPNGF+K +VHNV ELE+LMM NR YCAEIAH VS+KKRK IVERA QL + VTN  ARLRSQE E
Sbjct:   38 RGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPNGFRKVLVHNVRELEILMMQNRKYCAEIAHGVSSKKRKTIVERAQQLSIRVTNSAARLRSQENE 134          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL32_DROYA (60S ribosomal protein L32 OS=Drosophila yakuba GN=RpL32 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.384e-34
Identity = 71/97 (73.20%), Postives = 80/97 (82.47%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            KGID+RVRR+FK   LMPNIGYGS+K+TRH LP GFKKF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL V +TN   RLRSQE E
Sbjct:   38 KGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVLLMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE 134          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL32_DROSI (60S ribosomal protein L32 OS=Drosophila simulans GN=RpL32 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.384e-34
Identity = 71/97 (73.20%), Postives = 80/97 (82.47%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            KGID+RVRR+FK   LMPNIGYGS+K+TRH LP GFKKF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL V +TN   RLRSQE E
Sbjct:   38 KGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVLLMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE 134          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL32_DROME (60S ribosomal protein L32 OS=Drosophila melanogaster GN=RpL32 PE=1 SV=3)

HSP 1 Score: 145.206 bits (365), Expect = 2.384e-34
Identity = 71/97 (73.20%), Postives = 80/97 (82.47%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            KGID+RVRR+FK   LMPNIGYGS+K+TRH LP GFKKF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL V +TN   RLRSQE E
Sbjct:   38 KGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVLLMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE 134          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL32_RAT (60S ribosomal protein L32 OS=Rattus norvegicus GN=Rpl32 PE=1 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 3.113e-34
Identity = 69/97 (71.13%), Postives = 85/97 (87.63%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            +GID+RVRR+FK  +LMPNIGYGS+KKT+H LP+GF+KF+VHNV ELE+L+M N++YCAEIAHNVS+K RK IVERAAQL + VTN  ARLRS+E E
Sbjct:   39 RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE 135          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL32_PIG (60S ribosomal protein L32 OS=Sus scrofa GN=RPL32 PE=2 SV=3)

HSP 1 Score: 144.821 bits (364), Expect = 3.113e-34
Identity = 69/97 (71.13%), Postives = 85/97 (87.63%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            +GID+RVRR+FK  +LMPNIGYGS+KKT+H LP+GF+KF+VHNV ELE+L+M N++YCAEIAHNVS+K RK IVERAAQL + VTN  ARLRS+E E
Sbjct:   39 RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE 135          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL32_MOUSE (60S ribosomal protein L32 OS=Mus musculus GN=Rpl32 PE=2 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 3.113e-34
Identity = 69/97 (71.13%), Postives = 85/97 (87.63%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            +GID+RVRR+FK  +LMPNIGYGS+KKT+H LP+GF+KF+VHNV ELE+L+M N++YCAEIAHNVS+K RK IVERAAQL + VTN  ARLRS+E E
Sbjct:   39 RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE 135          
BLAST of CB304901 vs. ExPASy Swiss-Prot
Match: RL32_MACFA (60S ribosomal protein L32 OS=Macaca fascicularis GN=RPL32 PE=2 SV=3)

HSP 1 Score: 144.821 bits (364), Expect = 3.113e-34
Identity = 69/97 (71.13%), Postives = 85/97 (87.63%), Query Frame = -3
Query:  309 KGIDSRVRRKFKXCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 599
            +GID+RVRR+FK  +LMPNIGYGS+KKT+H LP+GF+KF+VHNV ELE+L+M N++YCAEIAHNVS+K RK IVERAAQL + VTN  ARLRS+E E
Sbjct:   39 RGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE 135          
The following BLAST results are available for this feature:
BLAST of CB304901 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
RL321_ARATH6.687e-4589.6960S ribosomal protein L32-1 OS=Arabidopsis thalian... [more]
RL322_ARATH4.334e-4486.6060S ribosomal protein L32-2 OS=Arabidopsis thalian... [more]
RL32_SPOFR4.803e-3574.2360S ribosomal protein L32 OS=Spodoptera frugiperda... [more]
RL32_DROYA2.384e-3473.2060S ribosomal protein L32 OS=Drosophila yakuba GN=... [more]
RL32_DROSI2.384e-3473.2060S ribosomal protein L32 OS=Drosophila simulans G... [more]
RL32_DROME2.384e-3473.2060S ribosomal protein L32 OS=Drosophila melanogast... [more]
RL32_RAT3.113e-3471.1360S ribosomal protein L32 OS=Rattus norvegicus GN=... [more]
RL32_PIG3.113e-3471.1360S ribosomal protein L32 OS=Sus scrofa GN=RPL32 P... [more]
RL32_MOUSE3.113e-3471.1360S ribosomal protein L32 OS=Mus musculus GN=Rpl32... [more]
RL32_MACFA3.113e-3471.1360S ribosomal protein L32 OS=Macaca fascicularis G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IaR_G07 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IaR_G07 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304901 ID=CB304901|Name=CB304901|organism=Citrus sinensis|type=EST|length=604bp
TTTTNNNTTTTTTTTTTTTTTTTTTTTTTTTGCTATTAAACATCATACGC
TTAACATTGCCCACTAATAGTTATGGAAAATATGCAAAACAATGTTAATA
AAAGGCTTGGCCATAAACCTTAACTCCTAAGTTGACATAACATTAATCAT
GCTCCGCAAAAAACAACAAATTCAAAATATCATTCAGGTGACAAAAATAA
AAAATACATCATAATTCAACCCTGGAAATGTTCATCCATTCCAAAGACAA
CCTAGGAAACATTTGGCCAAAAGCAAACACTAACATAAAATATAGAAACC
AATTTTTACTCCTCCTCCTGGCTGCGCAACCTGGCCAATTTGTTGGTGAC
CACAACATCCAATTGTGCAGCACGCTCGACAATCTCCTTTCTCTTCTTGG
TTGATACGTTGTGGGCTATCTCAGCACAATAAGTCCTGTTGTGCATCATC
AAGAGTTCCAGTTCATTGACATTGTGCACGACAAACTTCTTAAATCCATT
AGGCAGATAGTGGCGTGTTTTCTTGTCCGAGCCGTAACCAATATTGGGCA
TCAGAACACANNCTTTGAACTTTCTCCTGACACGTGAATCAATACCCTTC
NGCC
back to top