CB305010

Overview
NameCB305010
Unique NameCB305010
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length613
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 2.278e-35
Identity = 60/89 (67.42%), Postives = 68/89 (76.40%), Query Frame = -2
Query:  346 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDSFFHALDVNP 612
            ELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EAN+TLKQRLMEG  +N LQ   +A+D GYG +  Q QGD FFH L+  P
Sbjct:  125 ELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEP 212          

HSP 2 Score: 55.8398 bits (133), Expect = 2.278e-35
Identity = 26/33 (78.79%), Postives = 28/33 (84.85%), Query Frame = -1
Query:  257 CEPTLQIGYQPADPISVVTAGPSLNNYMQGWLP 355
            CEPTLQIGYQ  DPI+V  AGPS+NNYM GWLP
Sbjct:  210 CEPTLQIGYQN-DPITVGGAGPSVNNYMAGWLP 241          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.563e-33
Identity = 55/83 (66.27%), Postives = 63/83 (75.90%), Query Frame = -2
Query:  367 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGL-KPAQPQGDSFF 612
            +LE+LERQLD SLKQIRSTRTQ+MLD L +LQ KE LL EAN+ L+QR MEGYQ+N+LQLN SAED GYG        GD  F
Sbjct:  127 DLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRALRQR-MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELF 208          

HSP 2 Score: 62.3882 bits (150), Expect = 1.563e-33
Identity = 27/33 (81.82%), Postives = 28/33 (84.85%), Query Frame = -1
Query:  257 CEPTLQIGYQPADPISVVTAGPSLNNYMQGWLP 355
            CEPTLQIGY   DP SVVTAGPS+NNYM GWLP
Sbjct:  215 CEPTLQIGYHQGDPGSVVTAGPSMNNYMGGWLP 247          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 6.161e-25
Identity = 53/91 (58.24%), Postives = 66/91 (72.53%), Query Frame = -2
Query:  346 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPS-AEDCGYGLKPAQPQGDSFFHALDVNP 612
            ELE LERQLD SL+QIRSTRTQ+MLD L +LQ +EQ+L EANKTLK+R  E  Q N  Q+ +PS     GYG +PAQ  G++F+H L+  P
Sbjct:  123 ELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRFEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYHPLECEP 213          

HSP 2 Score: 34.6538 bits (78), Expect = 6.161e-25
Identity = 18/33 (54.55%), Postives = 22/33 (66.67%), Query Frame = -1
Query:  260 CEPTLQIGYQPADPISVVTAGPSLNNYM-QGWL 355
            CEPTLQIGY     ++  TA  ++NNYM  GWL
Sbjct:  211 CEPTLQIGYHSDITMATATAS-TVNNYMPPGWL 242          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 6.161e-25
Identity = 52/92 (56.52%), Postives = 65/92 (70.65%), Query Frame = -2
Query:  346 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCG-YGLKPAQPQ--GDSFFHALDVNP 612
            ELESLERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ E+   YG    Q Q    +FF  L+  P
Sbjct:  127 ELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQM-PLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEP 217          

HSP 2 Score: 44.2838 bits (103), Expect = 6.161e-25
Identity = 21/33 (63.64%), Postives = 23/33 (69.70%), Query Frame = -1
Query:  257 CEPTLQIGYQPADPISVVTAGPSLNNYMQGWLP 355
            CEP LQIGYQ       + AGPS+NNYM GWLP
Sbjct:  215 CEPILQIGYQGQQ--DGMGAGPSVNNYMLGWLP 245          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.993e-24
Identity = 53/94 (56.38%), Postives = 65/94 (69.15%), Query Frame = -2
Query:  346 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAED--CGYGLKPAQPQGDS---FFHALDVNP 612
            ELE LERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ ED    YG    Q Q +S   FF  L+  P
Sbjct:  127 ELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKTLRLRLADGYQM-PLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEP 219          

HSP 2 Score: 41.9726 bits (97), Expect = 2.993e-24
Identity = 20/33 (60.61%), Postives = 22/33 (66.67%), Query Frame = -1
Query:  257 CEPTLQIGYQPADPISVVTAGPSLNNYMQGWLP 355
            CEP LQ+GYQ      +  AGPS NNYM GWLP
Sbjct:  217 CEPILQMGYQGQQDHGM-EAGPSENNYMLGWLP 248          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: AGL9_SOLLC (Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.409e-18
Identity = 45/56 (80.36%), Postives = 49/56 (87.50%), Query Frame = -2
Query:  445 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN 612
            ELESLERQLDMSLKQIRSTRTQ MLD LT+ Q KE  L+EAN+TLKQRLMEG Q+N
Sbjct:  125 ELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTLKQRLMEGSQLN 180          

HSP 2 Score: 24.2534 bits (51), Expect = 3.409e-18
Identity = 11/24 (45.83%), Postives = 15/24 (62.50%), Query Frame = -3
Query:  354 VQKIVVMGLNQLNLRAIASFTPWM 425
            + K+  M   QL LRA+ASF  W+
Sbjct:  186 MHKLWAMAGKQLKLRAMASFILWI 209          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSJ (MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.134e-17
Identity = 44/91 (48.35%), Postives = 60/91 (65.93%), Query Frame = -2
Query:  355 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDSFFHALD 612
            ELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH LD
Sbjct:  126 ELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLD 216          

HSP 2 Score: 30.4166 bits (67), Expect = 2.134e-17
Identity = 16/32 (50.00%), Postives = 20/32 (62.50%), Query Frame = -1
Query:  257 EPTLQIGYQPADPISVVTAGPSLNNYMQGWLP 352
            EPTLQIGY PA+    + +   +N YM  WLP
Sbjct:  220 EPTLQIGY-PAEHHEAMNSA-CMNTYMPPWLP 249          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSI (MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.134e-17
Identity = 44/91 (48.35%), Postives = 60/91 (65.93%), Query Frame = -2
Query:  355 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDSFFHALD 612
            ELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH LD
Sbjct:  126 ELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLD 216          

HSP 2 Score: 30.4166 bits (67), Expect = 2.134e-17
Identity = 16/32 (50.00%), Postives = 20/32 (62.50%), Query Frame = -1
Query:  257 EPTLQIGYQPADPISVVTAGPSLNNYMQGWLP 352
            EPTLQIGY PA+    + +   +N YM  WLP
Sbjct:  220 EPTLQIGY-PAEHHEAMNSA-CMNTYMPPWLP 249          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: MADS8_ORYSJ (MADS-box transcription factor 8 OS=Oryza sativa subsp. japonica GN=MADS8 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.116e-15
Identity = 44/93 (47.31%), Postives = 60/93 (64.52%), Query Frame = -2
Query:  355 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGY------GLKPAQPQ-GDSFFHALD 612
            ELE LE+QLD SL+ IRSTRTQ+MLD LT+LQ +EQ+L EANK L+++L E  Q++       A   GY       ++   P  G+ FFH+L+
Sbjct:  126 ELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKLEESNQLHGQVWEHGATLLGYERQSPHAVQQVPPHGGNGFFHSLE 218          

HSP 2 Score: 25.0238 bits (53), Expect = 3.116e-15
Identity = 16/33 (48.48%), Postives = 18/33 (54.55%), Query Frame = -1
Query:  257 EPTLQIGYQPAD-PISVVTAGPSLNNYMQGWLP 352
            EPTLQIG+ P     S VTA      +M  WLP
Sbjct:  222 EPTLQIGFTPEQMNNSCVTA------FMPTWLP 248          
BLAST of CB305010 vs. ExPASy Swiss-Prot
Match: SEP1_ARATH (Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 4.504e-13
Identity = 41/95 (43.16%), Postives = 56/95 (58.95%), Query Frame = -2
Query:  346 ELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSA------EDCGYGLKPAQPQGDSFFHALDVNP 612
            ELE LERQLD SLKQ+RS +TQYMLD L++LQ+KEQ+L E N+ L  +L +   V +  +          ++  Y    AQ QG   +  L+ NP
Sbjct:  124 ELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQG--LYQPLECNP 216          

HSP 2 Score: 26.1794 bits (56), Expect = 4.504e-13
Identity = 13/37 (35.14%), Postives = 20/37 (54.05%), Query Frame = -1
Query:  260 CEPTLQIGYQP---ADPISVVTAGPSL--NNYMQGWL 355
            C PTLQ+GY     ++ I+  T   +   N Y+ GW+
Sbjct:  214 CNPTLQMGYDNPVCSEQITATTQAQAQQGNGYIPGWM 250          
The following BLAST results are available for this feature:
BLAST of CB305010 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
AGL9_PETHY2.278e-3567.42Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
MTF1_PEA1.563e-3366.27MADS-box transcription factor 1 OS=Pisum sativum G... [more]
AGL9_ARADE6.161e-2558.24Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
SEP3_ARATH6.161e-2556.52Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]
AGL9_SINAL2.993e-2456.38Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL9_SOLLC3.409e-1880.36Agamous-like MADS-box protein AGL9 homolog OS=Sola... [more]
MADS7_ORYSJ2.134e-1748.35MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS7_ORYSI2.134e-1748.35MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS8_ORYSJ3.116e-1547.31MADS-box transcription factor 8 OS=Oryza sativa su... [more]
SEP1_ARATH4.504e-1343.16Developmental protein SEPALLATA 1 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IIaR_F09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IIaR_F09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305010 ID=CB305010; Name=CB305010; organism=Citrus sinensis; type=EST; length=613bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTAAATAAAGATAAGCGCGGGGA
TTGAAAATACACGCACACACAACATAGCTATATATCGTCATCAGTTTCCC
TAAAGGGCAGGATAACTGTAGAGTTATTATAATAAATCCTTATGATTGCG
TGTTCCTAGTCACTGAATAGGGTTGCTTACAAAGGGATACAAAGTTGCTG
ATTCTTATGGATCAACTACAATACATTGACTGGTAATGCCCGCCGCTCTC
TTAGCATGGTAGCCATCCTTGCATGTAATTATTCAGACTCGGGCCTGCTG
TGACAACCGATATTGGGTCCGCAGGCTGGTATCCAATTTGCAATGTGGGT
TCACATCCAAGGCGTGAAAGAAGCTATCGCCCTGAGGTTGAGCTGGTTTA
AGCCCATAACCACAATCTTCTGCACTAGGATTCAATTGAAGTGTGTTCAC
TTGGTATCCCTCCATCAACCTTTGTTTGAGGGTCTTATTTGCTTCGCTCA
GCAACTGTTCCTTATGTTGCAGTTCAGTAAGGGTATCCAGCATGTACTGA
GTTCTTGTTGATCTGATCTGCTTCAATGACATATCAAGCTGCCTTTCAAG
TGACTCAAGCTCT
back to top