CB305011

Overview
NameCB305011
Unique NameCB305011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length628
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB305011 vs. ExPASy Swiss-Prot
Match: ARG2_PHAAU (Indole-3-acetic acid-induced protein ARG2 OS=Phaseolus aureus GN=ARG2 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.290e-17
Identity = 48/94 (51.06%), Postives = 57/94 (60.64%), Query Frame = -2
Query:  316 MARSFSNAKLFSALVADGISNAIYKRGYSAASQXXXXXXXXXXXXXXAMLKKPAEEMTGSSEKVSWVPDPVTGVYRPENLANELDGADLRAMFL 597
            MARSF+N K+ SALVADG SN   + G++AA+                M+ K  EE     EKVSWVPDPVTG YRPEN  NE+D AD+RA  L
Sbjct:    1 MARSFTNVKVLSALVADGFSNTTTRHGFAAAAAATQSATRGGASIGGNMVPKSGEEKVRGGEKVSWVPDPVTGYYRPEN-TNEIDVADMRATVL 93          
BLAST of CB305011 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 9.567e-13
Identity = 44/96 (45.83%), Postives = 55/96 (57.29%), Query Frame = -2
Query:  310 MARSFSNAKLFSALVADGISNAIYKRGYSAASQXXXXXXXXXXXXXXAMLKKPAEEMTGSSEKVSWVPDPVTGVYRPENLANELDGADLRAMFLKH 597
            MARS   AKL  A VADGIS +I +RGY+AA+                 L+    E +G+S   +W PDP+TG YRPEN A E+D A+LR M L H
Sbjct:    1 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKND--LRPAVREDSGASS--AWAPDPITGYYRPENRAVEIDPAELREMLLNH 92          
BLAST of CB305011 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.099e-12
Identity = 40/100 (40.00%), Postives = 53/100 (53.00%), Query Frame = -2
Query:  310 MARSFSNAKLFSALVADGISNAIYKRGYSAASQXXXXXXXXXXXXXXAMLKKPAEEMTGSSE----KVSWVPDPVTGVYRPENLANELDGADLRAMFLKH 597
            MARS S+ KL  A + DG+  +I +RGYS A                 + ++ A + + SSE      +W PDPVTG YRPEN   E+D A+LR M L H
Sbjct:    1 MARSVSSFKLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNH 100          
BLAST of CB305011 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.250e-11
Identity = 40/100 (40.00%), Postives = 51/100 (51.00%), Query Frame = -2
Query:  310 MARSFSNAKLFSALVADGISNAIYKRGYSAASQXXXXXXXXXXXXXXAMLKKPAEEMTGSSE----KVSWVPDPVTGVYRPENLANELDGADLRAMFLKH 597
            MARS S+ K   A V D +  +I +RGYS A                 + ++ A + + SSE      +W PDPVTG YRPEN   E+D ADLR M L H
Sbjct:    1 MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNH 100          
The following BLAST results are available for this feature:
BLAST of CB305011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ARG2_PHAAU1.290e-1751.06Indole-3-acetic acid-induced protein ARG2 OS=Phase... [more]
LEA5_CITSI9.567e-1345.83Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI8.099e-1240.00Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI5.250e-1140.00Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IIaR_F10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IIaR_F10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305011 ID=CB305011; Name=CB305011; organism=Citrus sinensis; type=EST; length=628bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGTAAATCATCTTTATTTCCG
AAAAATGGCAACAAAAAAACAGGAATGTTACATGCAATACAAAATCTAGT
TTGGATCCCCAAGTCAAAACAGAGAGAACAGGGGAGCTGCAGCTGCTACG
CCAATTTCCCGGAATTCCTCGAGAGCTCATGCGGCTGACCACATCAGAAC
AAATCCCTTTTTAACCTTTTTTTAATTTTTCTTTCGTCCTTCCTCAGTTT
CCATGTCCGAATTAATATATATTAATAATAATACTTATTAATTTTGATGA
TCAGTTGTTGTGCTTCAAGAACATGGCTCTGAGGTCGGCCCCATCGAGCT
CGTTGGCGAGATTCTCCGGCCTGTAGACACCAGTGACTGGGTCTGGGACC
CACGAGACCTTCTCACTGGATCCTGTCATCTCTTCTGCTGGTTTCTTCAA
CATCGCAGCAGCACTCCTAGCTCCCCCTGTTGCCCGCGACACAGCGCCTT
GTGATGCCGCCGAGTATCCTCTTTTGTAGATGGCGTTAGAGATTCCGTCA
GCGACGAGAGCAGAGAAAAGCTTAGCGTTTGAGAAAGAGCGAGCCATTTT
TCTTAGTTATGTGGGATGATGATGATGA
back to top