CB305026

Overview
NameCB305026
Unique NameCB305026
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length508
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB305026 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 8.572e-44
Identity = 88/91 (96.70%), Postives = 88/91 (96.70%), Query Frame = -2
Query:  235 KAKLLLAPVADGISLSIGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGAFSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 507
            KAKLLLAPVADGISLSI RRGYAAAAPLGTISRTGIMEKNDL PAVREDSGA SAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH
Sbjct:    7 KAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 97          
BLAST of CB305026 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.284e-19
Identity = 51/96 (53.12%), Postives = 63/96 (65.62%), Query Frame = -2
Query:  238 KLLLAPVADGISLSIGRRGYAAAAPLG---TISRTGIMEKNDLTPAVREDSGA-----FSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 501
            KLL A + DG+ +SI RRGY+ A P     +  R G M K +   A++E S +      SAWAPDP+TGYYRPEN   EID AELREMLLNH+VR+
Sbjct:    9 KLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRS 104          
BLAST of CB305026 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.070e-17
Identity = 48/96 (50.00%), Postives = 61/96 (63.54%), Query Frame = -2
Query:  238 KLLLAPVADGISLSIGRRGYAAAAPLG---TISRTGIMEKNDLTPAVREDSGA-----FSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 501
            K L A V D + +SI RRGY+ A P     +  R G M K +   A++E S +      SAWAPDP+TGYYRPEN   EID A+LREM+LNH+VR+
Sbjct:    9 KFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRS 104          
The following BLAST results are available for this feature:
BLAST of CB305026 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
LEA5_CITSI8.572e-4496.70Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI4.284e-1953.13Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI3.070e-1750.00Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IVaR_A07 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IVaR_A07 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305026 ID=CB305026; Name=CB305026; organism=Citrus sinensis; type=EST; length=508bp
TTTTNNTTTTTTTTTTTTTTTTTTTTTTTTGACACAGGCATTCTTTACTT
TTATTGACAAGTTAATAGAGACAAAATCATGGAAATGCACTATTAAAAGT
TGTAAATAACAGTTGATATCAAAACAACAGCAAAGACTTTAGAGTGAGTC
AAAATTGCTACTGTAACAACATCACTTAAAAGTTAAAGCACCGCTAACAG
CAAAGGATCTGCTGCTATGCGCGACCACTCCCTAGTGTGCCCTGACTTTG
TGGTTCAACAGCATCTCTCGAAGCTCTGCTGGATCAATCTCGACCGCCCG
ATTCTCCGGCCTGTAGTACCCAGTGATGGGATCTGGGGCCCAGGCAGAAA
AGGCCCCAGAATCCTCTCTCACCGCAGGCGTCAAATCATTTTTCTCCATG
ATACCAGTCCGAGATATGGTTCCCAAGGGTGCTGCTGCAGCATATCCTCT
CCTGCCAATGGAGAGCGAGATGCCATCAGCAACAGGAGCAAGAAGAAGCT
TAGCTTTG
back to top