CB305079

Overview
NameCB305079
Unique NameCB305079
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length634
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB305079_ssr172 microsatellite CB305079_ssr172:172..187. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6849 contig Csv1_Contig6849:426..1063. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HS16C_ORYSJ (16.9 kDa class I heat shock protein 3 OS=Oryza sativa subsp. japonica GN=HSP16.9C PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.767e-38
Identity = 79/119 (66.39%), Postives = 95/119 (79.83%), Query Frame = -1
Query:  263 SSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 619
            +S R+T+ FANAR+DWKETP++HVFKADLPG++         EG +L ISG+RSKE+E+KNDKWHRVERSSG+F+RRFRLP+NAKV+QVKASMENGVLTVT           KAIEISG
Sbjct:   31 TSDRDTAAFANARVDWKETPESHVFKADLPGVKKEEVKVEVEEGNVLVISGQRSKEKEDKNDKWHRVERSSGQFMRRFRLPENAKVDQVKASMENGVLTVTVPKAEVKKPEVKAIEISG 149          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HS17A_ORYSJ (17.9 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.9A PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.308e-38
Identity = 80/118 (67.80%), Postives = 92/118 (77.97%), Query Frame = -1
Query:  263 SARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 616
            ++ ET+ FA ARIDWKETP+AHVFKAD+PGL+         +G ILQISGER+KEQEEK D+WHRVERSSGKFLRRFRLPDNAK EQ+KASMENGVLTVT           K+I+ISG
Sbjct:   44 ASSETAAFAGARIDWKETPEAHVFKADVPGLKKEEVKVEVDDGNILQISGERNKEQEEKTDQWHRVERSSGKFLRRFRLPDNAKPEQIKASMENGVLTVTVPKEEAKKPDVKSIQISG 161          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 3.937e-38
Identity = 79/123 (64.23%), Postives = 94/123 (76.42%), Query Frame = -1
Query:  263 TNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 631
            ++A    +ET+ F N  IDWKETPQAHVFKADLPGL+         EG++LQISGER+KE+EEKNDKWHRVERSSGKFLRRFRLP+NAKV++VKA+M NGV+TVT           KAI+ISG
Sbjct:   35 SSASEFGKETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKAAMANGVVTVTVPKVEIKKPEVKAIDISG 157          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HSP12_SOLPE (17.6 kDa class I heat shock protein OS=Solanum peruvianum PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.715e-38
Identity = 80/119 (67.23%), Postives = 93/119 (78.15%), Query Frame = -1
Query:  263 SSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 619
            S++ ETS FAN RIDWKETP+AHVFKADLPGL+         E R+LQISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAK++QVKASMENGVLTVT           K+IEISG
Sbjct:   36 SNSGETSAFANTRIDWKETPEAHVFKADLPGLKKEEVKVEVEEDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVPKEEVNNPDVKSIEISG 154          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HS181_ORYSJ (18.1 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.145e-37
Identity = 77/118 (65.25%), Postives = 91/118 (77.12%), Query Frame = -1
Query:  263 SARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 616
            ++ ET+ FA ARIDWKETP+AHVFKAD+PGL+         +G +LQISGERSKEQEEK DKWHRVERSSGKFLRRFRLP+N K EQ+KASMENGVLTVT           K+I+++G
Sbjct:   44 TSSETAAFAGARIDWKETPEAHVFKADVPGLKKEEVKVEVEDGNVLQISGERSKEQEEKTDKWHRVERSSGKFLRRFRLPENTKPEQIKASMENGVLTVTVPKEEPKKPDVKSIQVTG 161          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.145e-37
Identity = 79/124 (63.71%), Postives = 95/124 (76.61%), Query Frame = -1
Query:  263 LTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 634
            L NA S+AR+ + F NAR+DWKETP+AHVFKADLPGL+         +  +LQISGERSKE EEKNDKWHRVER+SGKF+RRFRLP+NAK+E+VKA+MENGVLTV            K+I+ISG
Sbjct:   37 LANA-STARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDISG 159          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 1.496e-37
Identity = 79/124 (63.71%), Postives = 93/124 (75.00%), Query Frame = -1
Query:  263 LTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 634
            L NAP  A + + F NA++DW+ETP+AHVFKADLPGLR         +G ILQISGERS E EEKNDKWHRVERSSGKF RRFRLP+NAK+E++KASMENGVL+VT           K+I+ISG
Sbjct:   36 LANAP--AMDVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSVTVPKVPEKKPEVKSIDISG 157          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HS16B_ORYSJ (16.9 kDa class I heat shock protein 2 OS=Oryza sativa subsp. japonica GN=HSP16.9B PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.496e-37
Identity = 78/119 (65.55%), Postives = 93/119 (78.15%), Query Frame = -1
Query:  263 SSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 619
            +S  +T+ FANARIDWKETP++HVFKADLPG++         EG +L ISG+RSKE+E+KNDKWHRVERSSG+F+RRFRLP+NAKV+QVKA MENGVLTVT           KAIEISG
Sbjct:   32 TSDNDTAAFANARIDWKETPESHVFKADLPGVKKEEVKVEVEEGNVLVISGQRSKEKEDKNDKWHRVERSSGQFMRRFRLPENAKVDQVKAGMENGVLTVTVPKAEVKKPEVKAIEISG 150          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.954e-37
Identity = 77/120 (64.17%), Postives = 91/120 (75.83%), Query Frame = -1
Query:  263 PSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 622
            P  +RE S F + R+DWKETP+AHVFKAD+PGL+         + ++LQISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAKVEQVKASMENGVLTVT           KAIEISG
Sbjct:   42 PEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 161          
BLAST of CB305079 vs. ExPASy Swiss-Prot
Match: HSP11_SOLPE (17.7 kDa class I heat shock protein OS=Solanum peruvianum PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.954e-37
Identity = 79/119 (66.39%), Postives = 93/119 (78.15%), Query Frame = -1
Query:  263 SSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 619
            +++ ETS FAN RIDWKETP+AHVFKADLPGL+         E R+LQISGER+ E+E+KNDKW RVERSSGKF+RRFRLP+NAK++QVKASMENGVLTVT           K+IEISG
Sbjct:   36 TNSGETSAFANTRIDWKETPEAHVFKADLPGLKLEEVKVEVEEDRVLQISGERNMEKEDKNDKWQRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVPKEEMKKPDVKSIEISG 154          
The following BLAST results are available for this feature:
BLAST of CB305079 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HS16C_ORYSJ1.767e-3866.3916.9 kDa class I heat shock protein 3 OS=Oryza sat... [more]
HS17A_ORYSJ2.308e-3867.8017.9 kDa class I heat shock protein OS=Oryza sativ... [more]
HSP11_DAUCA3.937e-3864.2317.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP12_SOLPE6.715e-3867.2317.6 kDa class I heat shock protein OS=Solanum per... [more]
HS181_ORYSJ1.145e-3765.2518.1 kDa class I heat shock protein OS=Oryza sativ... [more]
HS181_ARATH1.145e-3763.7118.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17C_ARATH1.496e-3763.7117.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HS16B_ORYSJ1.496e-3765.5516.9 kDa class I heat shock protein 2 OS=Oryza sat... [more]
HSP16_SOYBN1.954e-3764.1718.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP11_SOLPE1.954e-3766.3917.7 kDa class I heat shock protein OS=Solanum per... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IVaR_G09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IVaR_G09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305079 ID=CB305079|Name=CB305079|organism=Citrus sinensis|type=EST|length=634bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTCATTACAAAATATATTTTA
TTGCATCACACTTTTATCATTTAAAAAACTAGTTACAACGCTTGAGACTG
GCTCCTGAAGCTCTTGCAAACACACAAACATAATCACAAAATTAAACAGG
GGGGAAGGGAAGCTCTTGCAAACACACACACACACACAAGGGCTTTGCTT
TCGTACCAAATTTATTAGCAAACCAAAGACACAATCTTGAAAACATTTAC
ACTTATCACTTAGCCAGAGATCTCAATGGCCTTAACTTCAGGTTTCTTCT
CCTCCTGTTTAGGAACAGTCACTGTGAGCACACCATTCTCCATGCTGGCC
TTAACCTGCTCCACCTTAGCATTGTCGGGCAACCTGAACCTCCTCAGGAA
CTTGCCACTGCTCCTCTCGACGCGATGCCACTTGTCATTCTTCTCTTCCT
GCTCCTTGCTCCTCTCCCCGCTTATCTGCAGAATCCTGCCCTCTTCAACC
TCAACTTTCACTTCTTCTTTCCTCAGCCCTGGAAGATCAGCCTTGAATAC
ATGAGCCTGAGGAGTCTCTTTCCAGTCAATTCTTGCATTGGCGAATTGGG
ATGTTTCCCTAGCCGAAGACGGCGCGTTGGTAAG
back to top