CB322101

Overview
NameCB322101
Unique NameCB322101
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length296
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3631 contig Csv1_Contig3631:164..459. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB322101 vs. ExPASy Swiss-Prot
Match: VA725_ARATH (Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana GN=VAMP725 PE=2 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 7.248e-46
Identity = 84/98 (85.71%), Postives = 90/98 (91.84%), Query Frame = 3
Query:    3 TEFTGNFTGIAAQCLQKLPXSNNKFTYNCDGHTFNYLVDDGFTYCVVAVESVGRQVPIAFLERVKEDFTKRYGGGKAATAVANGLNKEFGPKLKEHMQ 296
            TEF GNFT +AAQCLQKLP SNNKFTYNCDGHTFNYLV++GFTYCVVAVESVGRQ+P+AFLERVKEDF KRYGGGKA TA AN LN+EFG KLKEHMQ
Sbjct:   87 TEFKGNFTAVAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQ 184          
BLAST of CB322101 vs. ExPASy Swiss-Prot
Match: VA721_ARATH (Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana GN=VAMP721 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 7.248e-46
Identity = 84/98 (85.71%), Postives = 90/98 (91.84%), Query Frame = 3
Query:    3 TEFTGNFTGIAAQCLQKLPXSNNKFTYNCDGHTFNYLVDDGFTYCVVAVESVGRQVPIAFLERVKEDFTKRYGGGKAATAVANGLNKEFGPKLKEHMQ 296
            T+F GNFT IAAQCLQKLP SNNKFTYNCDGHTFNYLV+DGFTYCVVAV+S GRQ+P++FLERVKEDF KRYGGGKAATA AN LNKEFG KLKEHMQ
Sbjct:   22 TDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDGFTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQ 119          
BLAST of CB322101 vs. ExPASy Swiss-Prot
Match: VA722_ARATH (Vesicle-associated membrane protein 722 OS=Arabidopsis thaliana GN=VAMP722 PE=2 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 1.236e-45
Identity = 84/98 (85.71%), Postives = 90/98 (91.84%), Query Frame = 3
Query:    3 TEFTGNFTGIAAQCLQKLPXSNNKFTYNCDGHTFNYLVDDGFTYCVVAVESVGRQVPIAFLERVKEDFTKRYGGGKAATAVANGLNKEFGPKLKEHMQ 296
            T+F GNFT IAAQCLQKLP SNNKFTYNCDGHTFNYLV++GFTYCVVAV+S GRQ+P+AFLERVKEDF KRYGGGKAATA AN LNKEFG KLKEHMQ
Sbjct:   22 TDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQ 119          
BLAST of CB322101 vs. ExPASy Swiss-Prot
Match: VA726_ARATH (Putative vesicle-associated membrane protein 726 OS=Arabidopsis thaliana GN=VAMP726 PE=2 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 2.754e-45
Identity = 82/98 (83.67%), Postives = 88/98 (89.80%), Query Frame = 3
Query:    3 TEFTGNFTGIAAQCLQKLPXSNNKFTYNCDGHTFNYLVDDGFTYCVVAVESVGRQVPIAFLERVKEDFTKRYGGGKAATAVANGLNKEFGPKLKEHMQ 296
            TEF GNFT +AAQCLQKLP SNNKFTYNCDGHTFNYL D+GFTYCVV +ES GRQ+P+AFLERVKEDF KRYGGGKA+TA AN LNKEFG KLKEHMQ
Sbjct:   22 TEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLADNGFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQ 119          
BLAST of CB322101 vs. ExPASy Swiss-Prot
Match: VA723_ARATH (Vesicle-associated membrane protein 723 OS=Arabidopsis thaliana GN=VAMP723 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.259e-39
Identity = 75/98 (76.53%), Postives = 84/98 (85.71%), Query Frame = 3
Query:    3 TEFTGNFTGIAAQCLQKLPXSNNKFTYNCDGHTFNYLVDDGFTYCVVAVESVGRQVPIAFLERVKEDFTKRYGGGKAATAVANGLNKEFGPKLKEHMQ 296
            T+F GNFT +AAQ L+ LP SNNKFTYNCDGHTFN LV++GFTYCVVAV+S GR++P+AFLERVKEDF KRYGG KAAT  AN LNKEFG  LKEHMQ
Sbjct:   22 TDFKGNFTSVAAQYLENLPSSNNKFTYNCDGHTFNDLVENGFTYCVVAVDSAGREIPMAFLERVKEDFYKRYGGEKAATDQANSLNKEFGSNLKEHMQ 119          
BLAST of CB322101 vs. ExPASy Swiss-Prot
Match: VA724_ARATH (Vesicle-associated membrane protein 724 OS=Arabidopsis thaliana GN=VAMP724 PE=2 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 4.259e-38
Identity = 73/98 (74.49%), Postives = 84/98 (85.71%), Query Frame = 3
Query:    3 TEFTGNFTGIAAQCLQKLPXSNN-KFTYNCDGHTFNYLVDDGFTYCVVAVESVGRQVPIAFLERVKEDFTKRYGGGKAATAVANGLNKEFGPKLKEHM 293
            TEFTGNF  IAAQCLQKLP S+N KFTYNCD HTFN+LV+DG+ YCVVA +S+ +Q+ IAFLERVK DF KRYGGGKA+TA+A  LNKEFGP +KEHM
Sbjct:   22 TEFTGNFPSIAAQCLQKLPSSSNSKFTYNCDHHTFNFLVEDGYAYCVVAKDSLSKQISIAFLERVKADFKKRYGGGKASTAIAKSLNKEFGPVMKEHM 119          
BLAST of CB322101 vs. ExPASy Swiss-Prot
Match: VA727_ARATH (Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana GN=VAMP727 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.518e-27
Identity = 62/117 (52.99%), Postives = 76/117 (64.96%), Query Frame = 3
Query:    3 TEFTGNFTGIAAQCLQKLPXSNNKFTYNCDGHTFNYLVDDGFTYCVVAVESVGRQVPIAFLERVKEDFTKRYGGG-------------------KAATAVANGLNKEFGPKLKEHMQ 296
            T ++GNF+ IA QCLQKLP +++K+TY+CDGHTFN+LVD+GF + VVA ES GR VP  FLERVKEDF KRY                          +VA  L++EFGP LKEHMQ
Sbjct:   22 TPYSGNFSTIAVQCLQKLPTNSSKYTYSCDGHTFNFLVDNGFVFLVVADESTGRSVPFVFLERVKEDFKKRYEASIKNDERHPLADEDEDDDLFGDRFSVAYNLDREFGPILKEHMQ 138          
BLAST of CB322101 vs. ExPASy Swiss-Prot
Match: VAM7B_DICDI (Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum GN=vamp7B PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.353e-12
Identity = 37/97 (38.14%), Postives = 53/97 (54.64%), Query Frame = 3
Query:    3 TEFTGNFTGIAAQCLQKLPXSNNKFTYNCDGHTFNYLVDDGFTYCVVAVESVGRQVPIAFLERVKEDFTKRYGGGKAATAVANGLNKEFGPKLKEHM 293
            T   GNF  I  + L  +P ++ K +Y  + + F+YLV D  TY  +A E  GR++P  FL+ VK  F   Y G K  TA+A G+N +F   L+  M
Sbjct:   19 TSTNGNFVTITRRILDLIPPNDTKMSYVYEKYIFHYLVSDTLTYLCMADEEFGRRIPFTFLDDVKNRFKSMY-GDKGKTAIAYGMNSDFSRTLENLM 114          
The following BLAST results are available for this feature:
BLAST of CB322101 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
VA725_ARATH7.248e-4685.71Vesicle-associated membrane protein 725 OS=Arabido... [more]
VA721_ARATH7.248e-4685.71Vesicle-associated membrane protein 721 OS=Arabido... [more]
VA722_ARATH1.236e-4585.71Vesicle-associated membrane protein 722 OS=Arabido... [more]
VA726_ARATH2.754e-4583.67Putative vesicle-associated membrane protein 726 O... [more]
VA723_ARATH2.259e-3976.53Vesicle-associated membrane protein 723 OS=Arabido... [more]
VA724_ARATH4.259e-3874.49Vesicle-associated membrane protein 724 OS=Arabido... [more]
VA727_ARATH1.518e-2752.99Vesicle-associated membrane protein 727 OS=Arabido... [more]
VAM7B_DICDI2.353e-1238.14Vesicle-associated membrane protein 7B OS=Dictyost... [more]
back to top
Libraries
Library NameType
Mature leaf blade cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0210 Mature leaf blade cDNA subtraction library Citrus sinensis cDNA clone 24LB050 similar to putative synaptobrevin (acc# AAC04496), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB322101 ID=CB322101|Name=CB322101|organism=Citrus sinensis|type=EST|length=296bp
ACACGGAGTTCACCGGAAACTTCACCGGCATAGCTGCTCAGTGTCTCCAG
AAACTTCCTTNTAGTAACAACAAGTTCACTTACAATTGCGACGGCCACAC
TTTTAACTACCTCGTTGATGACGGCTTCACTTACTGTGTGGTTGCAGTTG
AATCTGTTGGTCGACAGGTTCCAATTGCCTTCCTTGAGCGTGTGAAAGAG
GATTTTACAAAGAGATATGGTGGAGGAAAAGCTGCAACAGCGGTCGCTAA
CGGCTTGAACAAGGAGTTTGGGCCCAAATTGAAGGAGCATATGCAG
back to top