CB417295

Overview
NameCB417295
Unique NameCB417295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length452
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6248 contig Csv1_Contig6248:7..458. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_ARATH (NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial OS=Arabidopsis thaliana GN=At4g02580 PE=1 SV=3)

HSP 1 Score: 220.705 bits (561), Expect = 2.253e-57
Identity = 106/125 (84.80%), Postives = 115/125 (92.00%), Query Frame = 2
Query:   80 EIRQAIR-PSLQASRSFSTALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            EIRQ  R P+ Q +RS STALNYHLDSPDN PDLPW+FS+ N+ KVKEILS+YPSNYKQSAVIPLLDLAQQQ+GGWLPVSAMN VAK+IEVAPIRVYEVATFYSMFNR+KVGKYHLLVCGTTPCM
Sbjct:   12 EIRQVFRQPTSQVTRSLSTALNYHLDSPDNKPDLPWEFSEANQSKVKEILSYYPSNYKQSAVIPLLDLAQQQNGGWLPVSAMNAVAKVIEVAPIRVYEVATFYSMFNRAKVGKYHLLVCGTTPCM 136          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_RAT (NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Rattus norvegicus GN=Ndufv2 PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 5.054e-33
Identity = 61/106 (57.55%), Postives = 87/106 (82.08%), Query Frame = 2
Query:  134 ALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            AL  H D+P+NNPD P+ F+  N E+++ I+ +YP  ++ +AV+P+LDLAQ+Q+G WLP+SAMN+VA++++V P+RVYEVATFY+M+NR  VGKYH+ VC TTPCM
Sbjct:   36 ALFVHRDTPENNPDTPFDFTPENYERIEAIVRNYPEGHRAAAVLPVLDLAQRQNG-WLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCM 140          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_PONPY (NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Pongo pygmaeus GN=NDUFV2 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 5.054e-33
Identity = 61/106 (57.55%), Postives = 87/106 (82.08%), Query Frame = 2
Query:  134 ALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            AL  H D+P+NNPD P+ F+  N ++++ I+ +YP  +K +AV+P+LDLAQ+Q+G WLP+SAMN+VA++++V P+RVYEVATFY+M+NR  VGKYH+ VC TTPCM
Sbjct:   37 ALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNG-WLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCM 141          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_PANTR (NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Pan troglodytes GN=NDUFV2 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 5.054e-33
Identity = 61/106 (57.55%), Postives = 87/106 (82.08%), Query Frame = 2
Query:  134 ALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            AL  H D+P+NNPD P+ F+  N ++++ I+ +YP  +K +AV+P+LDLAQ+Q+G WLP+SAMN+VA++++V P+RVYEVATFY+M+NR  VGKYH+ VC TTPCM
Sbjct:   37 ALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNG-WLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCM 141          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_HUMAN (NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens GN=NDUFV2 PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 5.054e-33
Identity = 61/106 (57.55%), Postives = 87/106 (82.08%), Query Frame = 2
Query:  134 ALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            AL  H D+P+NNPD P+ F+  N ++++ I+ +YP  +K +AV+P+LDLAQ+Q+G WLP+SAMN+VA++++V P+RVYEVATFY+M+NR  VGKYH+ VC TTPCM
Sbjct:   37 ALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNG-WLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCM 141          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_GORGO (NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFV2 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 5.054e-33
Identity = 61/106 (57.55%), Postives = 87/106 (82.08%), Query Frame = 2
Query:  134 ALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            AL  H D+P+NNPD P+ F+  N ++++ I+ +YP  +K +AV+P+LDLAQ+Q+G WLP+SAMN+VA++++V P+RVYEVATFY+M+NR  VGKYH+ VC TTPCM
Sbjct:   37 ALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNG-WLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCM 141          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_BOVIN (NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Bos taurus GN=NDUFV2 PE=1 SV=3)

HSP 1 Score: 138.658 bits (348), Expect = 1.126e-32
Identity = 61/106 (57.55%), Postives = 87/106 (82.08%), Query Frame = 2
Query:  134 ALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            AL  H D+P+NNP+ P+ F+  N ++++ I+ +YP  +K +AV+P+LDLAQ+Q+G WLP+SAMN+VA+I++V P+RVYEVATFY+M+NR  VGKYH+ VC TTPCM
Sbjct:   37 ALFVHRDTPENNPETPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNG-WLPISAMNKVAEILQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCM 141          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_MOUSE (NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Mus musculus GN=Ndufv2 PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 1.471e-32
Identity = 60/106 (56.60%), Postives = 87/106 (82.08%), Query Frame = 2
Query:  134 ALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            AL  H D+P+NNPD P+ F+  N ++++ I+ +YP  ++ +AV+P+LDLAQ+Q+G WLP+SAMN+VA++++V P+RVYEVATFY+M+NR  VGKYH+ VC TTPCM
Sbjct:   36 ALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPVLDLAQRQNG-WLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCM 140          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_CAEEL (Probable NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Caenorhabditis elegans GN=F53F4.10 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 5.588e-32
Identity = 65/111 (58.56%), Postives = 84/111 (75.68%), Query Frame = 2
Query:  119 RSFSTALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPCM 451
            R  +T L  H D+ +NN ++ +KF+  N+E++K I+  YP  +K  A+IPLLDLAQ+QHG WLP+SAM+EVAKI+EV  +R YEVATFY+MFNR  VGKY L VC TTPCM
Sbjct:   21 RGGATGLMVHRDTKENNLNVKFKFTSENQERIKAIMDIYPEGHKAGALIPLLDLAQRQHG-WLPISAMHEVAKILEVPRMRAYEVATFYTMFNRQPVGKYFLQVCATTPCM 130          
BLAST of CB417295 vs. ExPASy Swiss-Prot
Match: NDUV2_NEUCR (NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial OS=Neurospora crassa GN=nuo-24 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.245e-31
Identity = 60/112 (53.57%), Postives = 88/112 (78.57%), Query Frame = 2
Query:  113 ASRSFSTALNYHLDSPDNNPDLPWKFSDTNKEKVKEILSHYPSNYKQSAVIPLLDLAQQQHGGWLPVSAMNEVAKIIEVAPIRVYEVATFYSMFNRSKVGKYHLLVCGTTPC 448
            ++R  S  L  H ++PDNNPD+P+KFS  N++ ++EI+  YP  YK++AV+PLLDL Q+QH G+  +S MNEVA+++E+ P+RVYEVA+FY+M+NR+ VGK+H+  C TTPC
Sbjct:   38 SARRPSDTLMVHRNTPDNNPDIPFKFSADNEKVIEEIIKRYPPQYKKAAVMPLLDLGQRQH-GFCSISVMNEVARLLEMPPMRVYEVASFYTMYNRTPVGKFHVQACTTTPC 148          
The following BLAST results are available for this feature:
BLAST of CB417295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
NDUV2_ARATH2.253e-5784.80NADH-ubiquinone oxidoreductase 24 kDa subunit, mit... [more]
NDUV2_RAT5.054e-3357.55NADH dehydrogenase [ubiquinone] flavoprotein 2, mi... [more]
NDUV2_PONPY5.054e-3357.55NADH dehydrogenase [ubiquinone] flavoprotein 2, mi... [more]
NDUV2_PANTR5.054e-3357.55NADH dehydrogenase [ubiquinone] flavoprotein 2, mi... [more]
NDUV2_HUMAN5.054e-3357.55NADH dehydrogenase [ubiquinone] flavoprotein 2, mi... [more]
NDUV2_GORGO5.054e-3357.55NADH dehydrogenase [ubiquinone] flavoprotein 2, mi... [more]
NDUV2_BOVIN1.126e-3257.55NADH dehydrogenase [ubiquinone] flavoprotein 2, mi... [more]
NDUV2_MOUSE1.471e-3256.60NADH dehydrogenase [ubiquinone] flavoprotein 2, mi... [more]
NDUV2_CAEEL5.588e-3258.56Probable NADH dehydrogenase [ubiquinone] flavoprot... [more]
NDUV2_NEUCR1.245e-3153.57NADH-ubiquinone oxidoreductase 24 kDa subunit, mit... [more]

Pages

back to top
Libraries
Library NameType
Mature peel (flavedo) cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0368 Mature peel (flavedo) cDNA subtraction library Citrus sinensis cDNA clone 6P013 similar to NADH ubiquinone oxidoreductase (acc# NP_567244), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB417295 ID=CB417295|Name=CB417295|organism=Citrus sinensis|type=EST|length=452bp
ACCAAATCTGTGGCGTCACTCTTGTTGAGCTTAGAACTCGTCGAAAATGC
TAGCTCGTCTCGCGGCCAAGCGTCTTCTCGAGATTCGTCAAGCAATCCGT
CCATCTCTTCAGGCATCTCGATCTTTCTCCACTGCCCTGAACTATCATCT
TGATTCTCCAGATAACAATCCGGACCTTCCGTGGAAGTTCTCTGATACAA
ACAAAGAAAAGGTTAAGGAGATATTGTCTCACTATCCATCCAATTACAAG
CAATCTGCTGTCATTCCACTGCTAGATCTTGCACAGCAGCAGCATGGAGG
GTGGCTTCCTGTTTCAGCAATGAATGAGGTAGCTAAAATTATAGAGGTTG
CTCCCATCCGTGTATATGAGGTTGCAACATTTTATTCAATGTTCAACAGA
TCAAAGGTAGGCAAATACCACCTACTGGTCTGTGGCACAACACCTTGTAT
GG
back to top