CB417297

Overview
NameCB417297
Unique NameCB417297
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length590
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13846 contig Csv1_Contig13846:800..1391. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 7.377e-85
Identity = 84/87 (96.55%), Postives = 86/87 (98.85%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNHFVQEFKRKNKKDI+GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY+TITRARFEELNMDLFRKCMEPVEKC R
Sbjct:  242 RMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLR 328          

HSP 2 Score: 163.31 bits (412), Expect = 7.377e-85
Identity = 85/110 (77.27%), Postives = 86/110 (78.18%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD             ETAGGVMTVLIPRNTTIPTKKEQVFSTY
Sbjct:  328 RDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTY 437          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.622e-85
Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY+TITRARFEELNMDLFRKCMEPVEKC R
Sbjct:  242 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLR 328          

HSP 2 Score: 161.77 bits (408), Expect = 9.622e-85
Identity = 85/110 (77.27%), Postives = 85/110 (77.27%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD             ETAGG MTVLIPRNTTIPTKKEQVFSTY
Sbjct:  328 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGGMTVLIPRNTTIPTKKEQVFSTY 437          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 169.088 bits (427), Expect = 1.790e-83
Identity = 82/87 (94.25%), Postives = 86/87 (98.85%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNHFVQEFKRK+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLYEGIDFY+TITRARFEELNMDLFRKCMEPVEKC R
Sbjct:  242 RMVNHFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLR 328          

HSP 2 Score: 161.77 bits (408), Expect = 1.790e-83
Identity = 84/110 (76.36%), Postives = 85/110 (77.27%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD             ETAGGVMT LIPRNTTIPTKKEQVFSTY
Sbjct:  328 RDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTIPTKKEQVFSTY 437          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.053e-80
Identity = 82/87 (94.25%), Postives = 83/87 (95.40%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNHFV EFKRKNKKDISGN RALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY TITRARFEE+NMDLFRKCMEPVEKC R
Sbjct:  241 RMVNHFVSEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYATITRARFEEMNMDLFRKCMEPVEKCLR 327          

HSP 2 Score: 154.451 bits (389), Expect = 1.053e-80
Identity = 79/110 (71.82%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAK+DKS VH+VVLVGGSTRIPKV QLLQDFFNGKELCKSINPDE           ILSG+G+EKVQD             ETAGGVMTVLIPRNTTIPTKKEQ+FSTY
Sbjct:  327 RDAKIDKSQVHEVVLVGGSTRIPKVHQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGQGDEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTY 436          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.336e-80
Identity = 81/87 (93.10%), Postives = 85/87 (97.70%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNHFV EFKRK+KKDI+GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFY+TITRARFEELNMDLFRKCMEPVEKC R
Sbjct:  242 RMVNHFVHEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYSTITRARFEELNMDLFRKCMEPVEKCLR 328          

HSP 2 Score: 152.525 bits (384), Expect = 2.336e-80
Identity = 81/111 (72.97%), Postives = 85/111 (76.58%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQL-LQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAKMDKS+VHDVVLVGGSTRIPKVQQ+ + +FFNGKELCKSINPDE           ILSGEGNEKVQD             ETAGGVMTVLIPRNTTIPTKKEQVFSTY
Sbjct:  328 RDAKMDKSTVHDVVLVGGSTRIPKVQQVAMTNFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTY 438          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.047e-80
Identity = 81/87 (93.10%), Postives = 84/87 (96.55%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSL++GIDFY  ITRARFEELN+DLFRKCMEPVEKC R
Sbjct:  242 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFDGIDFYAPITRARFEELNIDLFRKCMEPVEKCLR 328          

HSP 2 Score: 153.68 bits (387), Expect = 3.047e-80
Identity = 81/110 (73.64%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAKMDK+S+ DVVLVGGSTRIPKVQQLL DFFNGKELCKSINPDE           ILSGEGNEKVQD             ETAGGVMTVLI RNTTIPTKKEQVFSTY
Sbjct:  328 RDAKMDKNSIDDVVLVGGSTRIPKVQQLLVDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIQRNTTIPTKKEQVFSTY 437          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 1.957e-79
Identity = 78/87 (89.66%), Postives = 82/87 (94.25%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNHFVQEFKRKNK+DI+G PRALRRLRTACERAKRTLSSTAQTTIEIDSLY G DFY+ ITRARFEE+NMDLFRKCMEPVEKC R
Sbjct:  242 RMVNHFVQEFKRKNKQDITGQPRALRRLRTACERAKRTLSSTAQTTIEIDSLYGGADFYSPITRARFEEMNMDLFRKCMEPVEKCLR 328          

HSP 2 Score: 156.762 bits (395), Expect = 1.957e-79
Identity = 81/110 (73.64%), Postives = 84/110 (76.36%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAKMDKS+VH++VLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD             ETAGGVMT LI RNTTIPTKKEQVFSTY
Sbjct:  328 RDAKMDKSTVHEIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTIPTKKEQVFSTY 437          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 163.31 bits (412), Expect = 9.635e-79
Identity = 85/110 (77.27%), Postives = 86/110 (78.18%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE           ILSGEGNEKVQD             ETAGGVMTVLIPRNTTIPTKKEQVFSTY
Sbjct:  328 RDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTY 437          

HSP 2 Score: 151.754 bits (382), Expect = 9.635e-79
Identity = 74/87 (85.06%), Postives = 79/87 (90.80%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNH +QEFKRKNKKDI   P  +RRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFY+ ITRARFEELN+DLFRKCMEPVEKC R
Sbjct:  242 RMVNHSLQEFKRKNKKDIMETPGHIRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYSPITRARFEELNIDLFRKCMEPVEKCLR 328          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 2.335e-77
Identity = 80/87 (91.95%), Postives = 82/87 (94.25%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCER 263
            RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSL+EGIDF    +RARFEELNMDLFRKCMEPVEKC R
Sbjct:  240 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFTPRSSRARFEELNMDLFRKCMEPVEKCLR 326          

HSP 2 Score: 149.058 bits (375), Expect = 2.335e-77
Identity = 82/110 (74.55%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  259 RDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            RDAKMDKSSVHDVVLVGGSTRIPKVQQL QDFFNGKELCKSINPDE           ILSGEGNE+  D             ETAGGVMTVLIPRNTTIPTKKEQVFSTY
Sbjct:  326 RDAKMDKSSVHDVVLVGGSTRIPKVQQL-QDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNER-SDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTY 433          
BLAST of CB417297 vs. ExPASy Swiss-Prot
Match: HSP70_CHLRE (Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 1.252e-72
Identity = 80/109 (73.39%), Postives = 82/109 (75.23%), Query Frame = 1
Query:  262 DAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXXXXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTY 588
            DAKMDK +VHDVVLVGGSTRIPKVQQLLQDFFNGKEL KSINPDE           IL+GEG EKVQD             ETAGGVMTVLIPRNTTIPTKKEQVFSTY
Sbjct:  329 DAKMDKMTVHDVVLVGGSTRIPKVQQLLQDFFNGKELNKSINPDEAVAYGAAVQAAILTGEGGEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTY 437          

HSP 2 Score: 143.28 bits (360), Expect = 1.252e-72
Identity = 68/85 (80.00%), Postives = 77/85 (90.59%), Query Frame = 3
Query:    3 RMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKC 257
            R+VNHF  EF+RK KKD+  +PRALRRLRTACERAKRTLSS AQTTIE+DSL+EG+DF T+ITRARFEEL MDLFRKCM+PVEKC
Sbjct:  242 RLVNHFANEFQRKYKKDLKTSPRALRRLRTACERAKRTLSSAAQTTIELDSLFEGVDFATSITRARFEELCMDLFRKCMDPVEKC 326          
The following BLAST results are available for this feature:
BLAST of CB417297 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP72_SOLLC7.377e-8596.55Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP7C_PETHY9.622e-8597.70Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP71_ARATH1.790e-8394.25Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP70_SOYBN1.053e-8094.25Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP71_SOLLC2.336e-8093.10Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP73_ARATH3.047e-8093.10Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP72_ARATH1.957e-7989.66Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP7E_SPIOL9.635e-7977.27Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP70_MAIZE2.335e-7791.95Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]
HSP70_CHLRE1.252e-7273.39Heat shock 70 kDa protein OS=Chlamydomonas reinhar... [more]

Pages

back to top
Libraries
Library NameType
Mature peel (flavedo) cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0370 Mature peel (flavedo) cDNA subtraction library Citrus sinensis cDNA clone 6P015 similar to 70 kDa heat shock protein (acc# AAL24367), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB417297 ID=CB417297|Name=CB417297|organism=Citrus sinensis|type=EST|length=590bp
ACAGAATGGTGAACCACTTTGTTCAAGAGTTCAAGAGGAAAAACAAGAAG
GATATTAGTGGAAACCCCAGAGCGTTGAGGAGGTTGAGAACTGCCTGTGA
AAGGGCTAAGAGGACCCTGTCATCAACCGCACAGACTACAATTGAGATTG
ATTCTTTATATGAGGGTATTGATTTCTACACAACCATTACAAGGGCTAGA
TTCGAAGAGTTGAACATGGATTTGTTCAGGAAGTGTATGGAGCCAGTGGA
GAAATGCGAGAGATGCTAAGATGGACAAGAGCAGTGTCCATGATGTGGTT
CTTGTTGGTGGGTCTACTAGGATCCCAAAAGTCCAGCAACTGTTGCAGGA
CTTCTTCAATGGAAAAGAGCTATGCAAGAGCATCAACCCTGATGAAGCGG
TTGCCTACGGTGCTGCTGTGCAGGCTGCAATCTTGAGTGGTGAGGGTAAT
GAGAAGGTTCAGGACCTCTTATTGCTTGACGTCACCCCTCTATCGCTGGG
TTTGGAGACTGCTGGTGGAGTCATGACTGTGTTGATTCCAAGGAACACCA
CTATTCCAACCAAGAAGGAGCAGGTGTTCTCCACATACTC
back to top