CB417302

Overview
NameCB417302
Unique NameCB417302
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3579 contig Csv1_Contig3579:158..887. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 8.346e-57
Identity = 111/163 (68.10%), Postives = 127/163 (77.91%), Query Frame = 2
Query:   62 MSLIPSFFGNRRSSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MSLIP FFG RRS+VFDPFSLD+WDPF+D                  E SAFV+TRVDWKETPEAHVFKAD+PGL+         DDR LQISG+RN+EKEDK+DTWHRVERSSG F+RRFRLPENAK++ +KASMENGVLTVTVPK EE KK +V+AI+ISG
Sbjct:    1 MSLIPGFFGGRRSNVFDPFSLDMWDPFKDFHVPTSSVS--------AENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFTRRFRLPENAKVNEVKASMENGVLTVTVPK-EEVKKPDVKAIEISG 154          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 8.346e-57
Identity = 112/163 (68.71%), Postives = 127/163 (77.91%), Query Frame = 2
Query:   62 MSLIPSFFGNRRSSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MSLIPS FG RRS+VFDPFSLDVWDPF+D                  E SAFVNTRVDWKETPEAHVF+AD+PGL+         DDR LQISG+RN+EKEDK+DTWHRVERSSG F RRFRLPENAK++++KASMENGVLTVTVPK EE KK +V+AI+ISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSLDVWDPFKDFHFPTSLS---------AENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVLTVTVPK-EEVKKPDVKAIEISG 153          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.859e-56
Identity = 110/163 (67.48%), Postives = 128/163 (78.53%), Query Frame = 2
Query:   62 MSLIPSFFGNRRSSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MSLIP+FFG RR++VFDPFSLDVWDPF+D                  E SAFV+TRVDWKETPEAHVFKAD+PGL+         DD+ LQISG+RN+EKEDK+DTWHRVERSSG F RRFRLPENAK++++KASMENGVLTVTVPK EE KK +V+AI+ISG
Sbjct:    1 MSLIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSASFPEFSR-ENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPK-EEVKKPDVKAIEISG 161          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.859e-56
Identity = 113/163 (69.33%), Postives = 125/163 (76.69%), Query Frame = 2
Query:   62 MSLIPSFFGNRRSSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MSLIPSFFG RRSSVFDPFSLDVWDPF+D                  E SAFV+TRVDWKETPEAHVFKAD+PGL+         D R LQISG+RN+EKEDK+DTWHRVERSSG   RRFRLPENAK+D++KASMENGVLTVTVPK EE KK +V+AI ISG
Sbjct:    1 MSLIPSFFGGRRSSVFDPFSLDVWDPFKDFPFPSSLS---------AENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPK-EEIKKPDVKAIDISG 153          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.205e-55
Identity = 110/163 (67.48%), Postives = 124/163 (76.07%), Query Frame = 2
Query:   62 MSLIPSFFGNRRSSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MSLIPSFFG RRS+VFDPFSLDVWDPF+D                  E SAFV+TRVDWKETPEAHVFKADLPG++         DDR LQISG+R++EKEDK+D WHR+ERSSG F RRFRLPENAKMD++KA+MENGVLTVTVPK EE KK  V+ I ISG
Sbjct:    1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPR----ENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPK-EEVKKPEVKTIDISG 158          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 2.056e-55
Identity = 111/163 (68.10%), Postives = 124/163 (76.07%), Query Frame = 2
Query:   62 MSLIPSFFGNRRSSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MSLIPSFF  RRS+VFDPFSLDVWDP +D                  E  AFV+TRVDWKETPEAHVFKADLPGL+         DDR LQISG+R++EKEDK+D WHRVERSSG F RRFRLPENAKMD++KASMENGVLTVTVPK EE KKA V++I+ISG
Sbjct:    1 MSLIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPR----ENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPK-EEIKKAEVKSIEISG 158          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HSP12_SOLPE (17.6 kDa class I heat shock protein OS=Solanum peruvianum PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.128e-53
Identity = 108/164 (65.85%), Postives = 125/164 (76.22%), Query Frame = 2
Query:   62 MSLIPSFFGNRRS-SVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MSLIP  FG+RRS SVFDPFS+DV+DPF++                 GE SAF NTR+DWKETPEAHVFKADLPGL+         +DR LQISG+RN+EKEDK+DTWHRVERSSG F RRFRLPENAKMD++KASMENGVLTVTVPK EE    +V++I+ISG
Sbjct:    1 MSLIPRIFGDRRSTSVFDPFSIDVFDPFKELGFTVSNS---------GETSAFANTRIDWKETPEAHVFKADLPGLKKEEVKVEVEEDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVPK-EEVNNPDVKSIEISG 154          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HSP15_SOYBN (17.6 kDa class I heat shock protein OS=Glycine max GN=HSP17.6-L PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.513e-53
Identity = 105/163 (64.42%), Postives = 123/163 (75.46%), Query Frame = 2
Query:   62 MSLIPSFFGNRRSSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MSLIPS FG  RS+VFDPFSLD+WDPF+D                  E SAFVNTRVDWKET EAHV KAD+PGL+         DDR LQISG+RN+EKEDK+DTWHRV+RSSG F RRFRLPENAK++++KA MENGVLTVT+PK EE KK++V+ I+ISG
Sbjct:    1 MSLIPSIFGGPRSNVFDPFSLDMWDPFKDFHVPTSSVS--------AENSAFVNTRVDWKETQEAHVLKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVDRSSGKFMRRFRLPENAKVEQVKACMENGVLTVTIPK-EEVKKSDVKPIEISG 154          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HS17B_ARATH (17.6 kDa class I heat shock protein 2 OS=Arabidopsis thaliana GN=HSP17.6B PE=2 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.282e-53
Identity = 106/164 (64.63%), Postives = 126/164 (76.83%), Query Frame = 2
Query:   62 MSLIPSFFGN-RRSSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEAKKANVRAIQISG 550
            MS+IPSFF N RRS++FDPFSLDVWDPF++                  E SA VN RVDW+ETPEAHVFKADLPGL+         +D  L+ISG+R++EKEDK+DTWHRVERSSG F+RRFRLPEN KMD++KA+MENGVLTVTVPKA E KKA+V++IQISG
Sbjct:    1 MSMIPSFFNNNRRSNIFDPFSLDVWDPFKELTSSSLSR----------ENSAIVNARVDWRETPEAHVFKADLPGLKKEEVKVEIEEDSVLKISGERHVEKEDKNDTWHRVERSSGQFTRRFRLPENVKMDQVKAAMENGVLTVTVPKA-ETKKADVKSIQISG 153          
BLAST of CB417302 vs. ExPASy Swiss-Prot
Match: HS178_ARATH (17.8 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.8 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 5.598e-53
Identity = 106/166 (63.86%), Postives = 123/166 (74.10%), Query Frame = 2
Query:   62 MSLIPSFFGNRR--SSVFDPFSLDVWDPFRDXXXXXXXXXXXXXXXXXGEASAFVNTRVDWKETPEAHVFKADLPGLRXXXXXXXXXDDRALQISGQRNIEKEDKSDTWHRVERSSGMFSRRFRLPENAKMDRIKASMENGVLTVTVPKAEEA-KKANVRAIQISG 550
            MSLIPSFFGN R  +S+FDPFSLDVWDPF++                 GE SA  N RVDWKET EAHVFKADLPG++         DD  L+ISG+R++EKE+K DTWHRVERSSG FSR+F+LPEN KMD++KASMENGVLTVTVPK EEA KKA V++I ISG
Sbjct:    1 MSLIPSFFGNNRRSNSIFDPFSLDVWDPFKELQFPSSLS---------GETSAITNARVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGQFSRKFKLPENVKMDQVKASMENGVLTVTVPKVEEAKKKAQVKSIDISG 157          
The following BLAST results are available for this feature:
BLAST of CB417302 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 57
Match NameE-valueIdentityDescription
HSP14_SOYBN8.346e-5768.1017.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN8.346e-5768.7117.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP16_SOYBN1.859e-5667.4818.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP11_SOYBN1.859e-5669.3317.3 kDa class I heat shock protein OS=Glycine max... [more]
HSP12_MEDSA1.205e-5567.4818.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP11_PEA2.056e-5568.1018.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP12_SOLPE1.128e-5365.8517.6 kDa class I heat shock protein OS=Solanum per... [more]
HSP15_SOYBN2.513e-5364.4217.6 kDa class I heat shock protein OS=Glycine max... [more]
HS17B_ARATH3.282e-5364.6317.6 kDa class I heat shock protein 2 OS=Arabidops... [more]
HS178_ARATH5.598e-5363.8617.8 kDa class I heat shock protein OS=Arabidopsis... [more]

Pages

back to top
Libraries
Library NameType
Mature peel (flavedo) cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0377 Mature peel (flavedo) cDNA subtraction library Citrus sinensis cDNA clone 6P022 similar to small heat shock protein (acc# 1107298A), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB417302 ID=CB417302|Name=CB417302|organism=Citrus sinensis|type=EST|length=730bp
ACTTTTTATTAGTCGATAGAGGAAAGAGAGAGGGAAAACAAAAAAAGGAA
AGATAAGGAAAATGTCGCTGATTCCAAGCTTCTTCGGCAACCGACGCAGC
AGTGTGTTCGATCCGTTCTCACTCGACGTTTGGGATCCATTCAGGGACTT
CCCTCTCTCTGCTTCTTCTTTTCCATCTGCGGTGTCCTCTCAGTTCCCTG
GAGAAGCCTCTGCTTTCGTTAATACCCGCGTGGACTGGAAGGAAACCCCA
GAGGCCCACGTGTTCAAGGCTGATCTTCCGGGGCTAAGGAAAGAGGAGGT
GAAGGTCGAGGTTGAGGATGACAGGGCGCTTCAGATAAGCGGGCAGAGGA
ACATTGAGAAGGAAGACAAGAGCGACACGTGGCATCGCGTGGAGCGTAGC
AGTGGCATGTTCTCGAGGAGGTTCAGGCTGCCGGAGAATGCGAAGATGGA
CCGCATTAAGGCTTCAATGGAGAACGGTGTGCTTACTGTTACCGTTCCTA
AAGCGGAGGAGGCCAAGAAAGCTAATGTCAGGGCTATTCAAATCTCTGGC
TGACTAATTAATAAACAAAGACAATAAATAATTGTATGATAAGTTTTATG
GTTTGGTTTGGTCTATGTATCATGTGAAGTCTGTCTTTGTCTACTGAGAT
CGAGTGTCTTTGTTTGTAATGGGAATGTCAGAATGGGAATAATAATGTAA
TTTCGTAAAAAAAAAAAAAAAAAAAAAAAA
back to top