CB417306

Overview
NameCB417306
Unique NameCB417306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length357
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.673e-24
Identity = 50/88 (56.82%), Postives = 66/88 (75.00%), Query Frame = 3
Query:   93 IDTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            + T++DWKETP AHVF+ D+PGL KE+V +Q+  DR+L IS ER  E EDK D WH  ER   G FTR+FRLP++ KV+E++ASM +G
Sbjct:   45 VSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVER-SSGKFTRRFRLPENAKVNEVKASMENG 131          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 5.955e-24
Identity = 49/88 (55.68%), Postives = 67/88 (76.14%), Query Frame = 3
Query:   93 IDTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            ++T++DWKETP AHVFE D+PGL KE+V +Q+  DR+L IS ER  E EDK D WH  ER   G+F R+FRLP++ KV++++ASM +G
Sbjct:   44 VNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVER-SSGNFMRRFRLPENAKVEQVKASMENG 130          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP11_SOLLC (17.8 kDa class I heat shock protein OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 5.955e-24
Identity = 49/87 (56.32%), Postives = 66/87 (75.86%), Query Frame = 3
Query:   96 DTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            +T++DWKETP  HVF++DLPGL KE+V ++V  DR+L IS ER  E EDK DKWH  ER   G F R+FRLP++ K+D+++ASM +G
Sbjct:   46 NTRIDWKETPEPHVFKVDLPGLKKEEVKVEVEEDRVLQISGERNVEKEDKNDKWHRMER-SSGKFMRRFRLPENAKMDQVKASMENG 131          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.327e-23
Identity = 49/88 (55.68%), Postives = 66/88 (75.00%), Query Frame = 3
Query:   93 IDTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            + T++DWKETP AHVF+ DLPGL KE+V ++V  DR+L IS ER  E EDK D+WH  ER   G F R+FRLP++ K+D+++ASM +G
Sbjct:   49 VSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVER-SSGKFLRRFRLPENAKMDKVKASMENG 135          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP11_MEDSA (18.1 kDa class I heat shock protein (Fragment) OS=Medicago sativa GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.955e-23
Identity = 47/88 (53.41%), Postives = 66/88 (75.00%), Query Frame = 3
Query:   93 IDTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            + T++DWKETP AHVF+ DLPGL KE+V +++  DR+L IS ER  E EDK D+WH  ER   G F R+FRLP++ K+D+++A+M +G
Sbjct:   34 VSTRIDWKETPEAHVFKADLPGLKKEEVKVEIEDDRVLQISGERNVEKEDKNDQWHRVER-SSGKFMRRFRLPENAKMDQVKAAMENG 120          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP12_SOLPE (17.6 kDa class I heat shock protein OS=Solanum peruvianum PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.860e-23
Identity = 49/87 (56.32%), Postives = 65/87 (74.71%), Query Frame = 3
Query:   96 DTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            +T++DWKETP AHVF+ DLPGL KE+V ++V  DR+L IS ER  E EDK D WH  ER   G F R+FRLP++ K+D+++ASM +G
Sbjct:   46 NTRIDWKETPEAHVFKADLPGLKKEEVKVEVEEDRVLQISGERNVEKEDKNDTWHRVER-SSGKFMRRFRLPENAKMDQVKASMENG 131          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.860e-23
Identity = 46/88 (52.27%), Postives = 66/88 (75.00%), Query Frame = 3
Query:   93 IDTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            + T++DWKETP AHVF+ DLPG+ KE+V +++  DR+L IS ER  E EDK D+WH  ER   G F R+FRLP++ K+D+++A+M +G
Sbjct:   49 VSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLER-SSGKFMRRFRLPENAKMDQVKAAMENG 135          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 5.041e-23
Identity = 47/88 (53.41%), Postives = 65/88 (73.86%), Query Frame = 3
Query:   93 IDTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            + T++DWKETP AHVF+ D+PGL KE+V +Q+  D++L IS ER  E EDK D WH  ER   G F R+FRLP++ KV++++ASM +G
Sbjct:   52 VSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVER-SSGKFMRRFRLPENAKVEQVKASMENG 138          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.123e-22
Identity = 47/88 (53.41%), Postives = 66/88 (75.00%), Query Frame = 3
Query:   93 IDTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            ++T +DWKETP AHVF+ DLPGL KE+V +++   ++L IS ER +E E+K DKWH  ER   G F R+FRLP++ KVDE++A+M +G
Sbjct:   48 VNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVER-SSGKFLRRFRLPENAKVDEVKAAMANG 134          
BLAST of CB417306 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.916e-22
Identity = 47/88 (53.41%), Postives = 63/88 (71.59%), Query Frame = 3
Query:   93 IDTQMDWKETPHAHVFEIDLPGLAKEDVTLQVHGDRILHISAERKEEPEDKGDKWHCRERPHGGSFTRQFRLPDDVKVDEIRASMRDG 356
            + T++DWKETP AHVF+ D+PGL KE+V L++   R+L IS ER  E EDK D WH  ER   G   R+FRLP++ KVD+++ASM +G
Sbjct:   44 VSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVER-SSGKLVRRFRLPENAKVDQVKASMENG 130          
The following BLAST results are available for this feature:
BLAST of CB417306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
HSP14_SOYBN2.673e-2456.8217.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN5.955e-2455.6817.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP11_SOLLC5.955e-2456.3217.8 kDa class I heat shock protein OS=Solanum lyc... [more]
HSP11_PEA1.327e-2355.6818.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_MEDSA2.955e-2353.4118.1 kDa class I heat shock protein (Fragment) OS=... [more]
HSP12_SOLPE3.860e-2356.3217.6 kDa class I heat shock protein OS=Solanum per... [more]
HSP12_MEDSA3.860e-2352.2718.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP16_SOYBN5.041e-2353.4118.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP11_DAUCA1.123e-2253.4117.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP11_SOYBN1.916e-2253.4117.3 kDa class I heat shock protein OS=Glycine max... [more]

Pages

back to top
Libraries
Library NameType
Mature peel (flavedo) cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0382 Mature peel (flavedo) cDNA subtraction library Citrus sinensis cDNA clone 6P027 similar to 17.7 kDa heat shock protein, class I (acc# AAN64316), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB417306 ID=CB417306|Name=CB417306|organism=Citrus sinensis|type=EST|length=357bp
TATATAATATAATTTAAACGAGAAACTAGAGTTGAACAAAAATGTCTCTC
CTCCCTGTTGGGATATCATCTCTCGTCCATCCATATGGAGGCATAGACAC
CCAGATGGACTGGAAAGAAACTCCACATGCCCACGTATTCGAGATCGATC
TTCCAGGGCTTGCAAAAGAGGATGTGACGCTTCAAGTTCATGGAGACAGG
ATACTTCACATAAGTGCTGAGAGGAAAGAGGAGCCAGAGGACAAAGGCGA
CAAGTGGCACTGCCGGGAGAGGCCACACGGCGGCAGCTTCACCAGGCAGT
TTCGTTTGCCTGATGATGTTAAGGTCGATGAGATTAGGGCTTCAATGCGT
GACGGGG
back to top