CB417311

Overview
NameCB417311
Unique NameCB417311
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length683
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12212 contig Csv1_Contig12212:278..960. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HSFA2_ARATH (Heat stress transcription factor A-2 OS=Arabidopsis thaliana GN=HSFA2 PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.332e-65
Identity = 126/222 (56.76%), Postives = 164/222 (73.87%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRHVS-QSMQQRG-GEACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLVQSNAHRRELGGVQTGRKRRLTATPSMENLQETISVAPVGLDCGPVVDYTVQDQNELTSMETEIETFLSSPVDNESSSDI 661
            LP+YFKHSNFSSFIRQLNTYGFRK+DPDRWEFANEGFL GQKHLLK IKRRR++  Q++ Q+G G +C+EVGQYG DGE+ERLKRD  VL+AE+VRLRQ Q  S+ Q++AME RLL TEK+QQQMMTFLAKAL NP+F QQ    +  ++ L G+  GRKRRLT+TPS+  ++E +                + DQ E   M+ ++E   ++ +D+E+++ +
Sbjct:   84 LPRYFKHSNFSSFIRQLNTYGFRKIDPDRWEFANEGFLAGQKHLLKNIKRRRNMGLQNVNQQGSGMSCVEVGQYGFDGEVERLKRDHGVLVAEVVRLRQQQHSSKSQVAAMEQRLLVTEKRQQQMMTFLAKALNNPNFVQQFAVMSKEKKSLFGLDVGRKRRLTSTPSLGTMEENL----------------LHDQ-EFDRMKDDMEMLFAAAIDDEANNSM 288          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HSF30_SOLPE (Heat shock factor protein HSF30 OS=Solanum peruvianum GN=HSF30 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.332e-65
Identity = 124/220 (56.36%), Postives = 161/220 (73.18%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRHVSQSMQQRGGEACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLVQSNAHRRELGGVQTGRKRRLTATPSMENLQETISVAPVGLDCGPVVDYTVQDQNELTSMETEIETFLSSPVDNESSSDI 661
            LP++FKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRR+V QSM Q+G  AC+E+G YG++ ELERLKRD+NVLM EIV+LRQ QQ +R+Q+ AM +++ + E+KQ QMM+FLAK   NP+F QQ +    HR++   ++ G+KRRLT TPS+    + ++ +              + + EL S    IE   S+ +DNESSS++
Sbjct:   71 LPRFFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRNVGQSMNQQGSGACIEIGYYGMEEELERLKRDKNVLMTEIVKLRQQQQSTRNQIIAMGEKIETQERKQVQMMSFLAKIFSNPTFLQQYLDKQVHRKDKQRIEVGQKRRLTMTPSVTGSDQPMNYS----------SSLQESEAELAS----IEMLFSAAMDNESSSNV 276          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HFA2C_ORYSJ (Heat stress transcription factor A-2c OS=Oryza sativa subsp. japonica GN=HSFA2C PE=2 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 7.665e-54
Identity = 110/221 (49.77%), Postives = 148/221 (66.97%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRHVSQS--MQQRGGEACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLVQSNAHRRELGGVQTGRKRRLTATPSMENLQETISV----APVGLDCGPVVDYTVQDQNELTSMETEIETFLSSPVDNE 646
            LP+ FKH+NFSSF+RQLNTYGFRKVDPDRWEFANEGFL GQ+HLLKTIKRR+  S +   QQ+   +CLEVG++G + E++RLKRD+N+L+ E+V+LRQ QQ ++D + AMEDRL + E+KQ QMM FLA+A++NP FFQQL Q    R+EL    + ++RR        +  ET       +P   D G + + +     EL ++   I+      VD E
Sbjct:   82 LPRLFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQRHLLKTIKRRKPPSNAPPSQQQSLTSCLEVGEFGFEEEIDRLKRDKNILITEVVKLRQEQQATKDHVKAMEDRLRAAEQKQVQMMGFLARAMRNPEFFQQLAQQKEKRKELEDAISKKRRRPIDNVPFYDPGETSQTEQLDSPYLFDSGVLNELSEPGIPELENLAVNIQDLGKGKVDEE 302          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HFA2B_ORYSJ (Heat stress transcription factor A-2b OS=Oryza sativa subsp. japonica GN=HSFA2B PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 9.369e-52
Identity = 100/180 (55.56%), Postives = 133/180 (73.89%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRR---HVSQSMQQRGGEACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLVQSNAHRREL-GGVQTGRKRRLTATPSMENLQETISV 529
            LP++FKH+NFSSF+RQLNTYGFRKVDPDRWEFANE FL GQ+HLLK IKRR+   H + + Q  G    LEVG +G D E++RLKRD+ +LMAE+V+LRQ QQ ++  L AMEDRL  TE++QQQMM FLA+ +KNP F +QL+  N  R+EL   +   R+RR+   P ++++  + S+
Sbjct:   92 LPRFFKHNNFSSFVRQLNTYGFRKVDPDRWEFANENFLRGQRHLLKNIKRRKPPSHTASNQQSLG--PYLEVGHFGYDAEIDRLKRDKQLLMAEVVKLRQEQQNTKANLKAMEDRLQGTEQRQQQMMAFLARVMKNPEFLKQLMSQNEMRKELQDAISKKRRRRIDQGPEVDDVGTSSSI 269          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HFA2E_ORYSJ (Heat stress transcription factor A-2e OS=Oryza sativa subsp. japonica GN=HSFA2E PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.036e-50
Identity = 95/171 (55.56%), Postives = 130/171 (76.02%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRHVSQSMQQRGGEACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLVQSNAHRRELGG-VQTGRKRRLTATPSMENL 511
            LP+YFKH+NFSSF+RQLNTYGFRKVDPD+WEFANEGFL GQKHLLK+IKRR+  + S  Q+   + LEVG +G +GE+++LKRD+++LMAE+V+LRQ QQ ++  L AME +L  TE+KQQ MM FL++ + NP F +QL   +  R+EL   V   R+RR+   P ++++
Sbjct:   78 LPRYFKHNNFSSFVRQLNTYGFRKVDPDKWEFANEGFLRGQKHLLKSIKRRKPPNSSPSQQSLGSFLEVGHFGYEGEIDQLKRDKHLLMAEVVKLRQEQQNTKSDLQAMEQKLQGTEQKQQHMMAFLSRVMHNPEFIRQLFSQSEMRKELEEFVSKKRRRRIDQGPELDSM 248          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HFA2A_ORYSJ (Heat stress transcription factor A-2a OS=Oryza sativa subsp. japonica GN=HSFA2A PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.141e-50
Identity = 103/177 (58.19%), Postives = 126/177 (71.19%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRR------------HVSQSMQQRGGEACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLV-----QSNAHRRELGGVQTGRKRR 481
            LP+YFKHSNFSSF+RQLNTYGFRKVDPDRWEFANEGFL G+K LLKTIKRRR              S   QQ+   ACLEVGQ+G DG + RL+RD++VL+AE+V+LRQ QQ +R Q+ AME+R+ + E+KQQQM  FLA+A+KNP F Q LV     Q  A  R L    + ++RR
Sbjct:   93 LPRYFKHSNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGKKELLKTIKRRRPPPSSPPSSSSSSSSSQHQQQPAAACLEVGQFGRDGVVNRLQRDKSVLIAEVVKLRQEQQTTRAQMQAMEERISAAEQKQQQMTVFLARAMKNPGFLQMLVDRQAGQHGARNRVLEDALSKKRRR 269          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HFA6B_ARATH (Heat stress transcription factor A-6b OS=Arabidopsis thaliana GN=HSFA6b PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.552e-49
Identity = 93/169 (55.03%), Postives = 129/169 (76.33%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRHVSQSMQQRGGEA---------CLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLVQSNAHRRELGGVQTGRKRR 481
            LP++FKH+NFSSF+RQLNTYGFRKV+PDRWEFANEGFL GQKHLLK I+RR+  + S Q +  ++         C+EVG+YGLDGE++ L+RD+ VLM E+VRLRQ QQ ++  L+ +E++L  TE KQ+QMM+FLA+A++NP F QQLV+    R+E+    + +++R
Sbjct:  101 LPRFFKHNNFSSFVRQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKNIRRRKTSNNSNQMQQPQSSEQQSLDNFCIEVGRYGLDGEMDSLRRDKQVLMMELVRLRQQQQSTKMYLTLIEEKLKKTESKQKQMMSFLARAMQNPDFIQQLVEQKEKRKEIEEAISKKRQR 269          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HSFA1_ORYSJ (Heat stress transcription factor A-1 OS=Oryza sativa subsp. japonica GN=HSFA1 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.352e-49
Identity = 103/169 (60.95%), Postives = 126/169 (74.56%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRR--HVSQSMQQ-----RGGEACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLVQSNAH-RRELGGVQTGRKRRL 484
            LPKYFKHSNFSSF+RQLNTYGFRKVDPDRWEFANEGFL GQKHLLKTI RR+  H +  +QQ         AC+EVG++G++ E+E LKRD+NVLM E+VRLRQ QQ +  QL  +  RL   E++QQQMM+FLAKA+ +P F  Q VQ N + RR +  V + +KRRL
Sbjct:   77 LPKYFKHSNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKTINRRKPTHGNNQVQQPQLPAAPVPACVEVGKFGMEEEIEMLKRDKNVLMQELVRLRQQQQTTDHQLQTLGKRLQGMEQRQQQMMSFLAKAMHSPGFLAQFVQQNENSRRRI--VASNKKRRL 243          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HSF8_SOLPE (Heat shock factor protein HSF8 OS=Solanum peruvianum GN=HSF8 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.684e-49
Identity = 115/238 (48.32%), Postives = 148/238 (62.18%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRR--------------HVSQSMQQRGGE----ACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLV-QSNAHRRELGGVQTGRKRRLTATPSMENLQETISVAPVGLDCGPVVDYTVQDQNELTSMETEIETFLSSP-VDNESSS 655
            LPKYFKH+NFSSF+RQLNTYGFRKVDPDRWEFANEGFL GQKHLLK+I RR+              H  Q MQ  G      AC+EVG++GL+ E+ERLKRD+NVLM E+VRLRQ QQ + +QL  M  RL   E +QQQMM+FLAKA+ +P F  Q V Q N   + +   +  +KRR+     +E+   +++ A      G +V Y         +M  E+    SSP ++N S+S
Sbjct:   81 LPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSISRRKPAHGHAQQQQQPHGHAQQQMQPPGHSASVGACVEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQSTDNQLQGMVQRLQGMELRQQQMMSFLAKAVNSPGFLAQFVQQQNESNKRI--AEGSKKRRI--KQDIESQDPSVTPAD-----GQIVKYQPGINEAAKAMLRELSKLDSSPRLENFSNS 309          
BLAST of CB417311 vs. ExPASy Swiss-Prot
Match: HSF8_SOLLC (Heat shock factor protein HSF8 OS=Solanum lycopersicum GN=HSF8 PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.684e-49
Identity = 115/238 (48.32%), Postives = 146/238 (61.34%), Query Frame = 2
Query:    2 LPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRR----HVSQSMQQRGGE--------------ACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLV-QSNAHRRELGGVQTGRKRRLTATPSMENLQETISVAPVGLDCGPVVDYTVQDQNELTSMETEIETFLSSP-VDNESSS 655
            LPKYFKH+NFSSF+RQLNTYGFRKVDPDRWEFANEGFL GQKHLLK+I RR+    H  Q  Q  G                AC+EVG++GL+ E+ERLKRD+NVLM E+VRLRQ QQ + +QL  M  RL   E +QQQMM+FLAKA+  P F  Q V Q N   + +   +  +KRR+     +E+   +++ A      G +V Y         +M  E+    SSP +DN S+S
Sbjct:   79 LPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSISRRKPAHGHAQQQQQPHGNAQQQMQPPGHSASVGACVEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQATDNQLQGMVQRLQGMELRQQQMMSFLAKAVNRPGFLAQFVQQQNESNKRI--AEGSKKRRI--KQDIESQDPSVTPAD-----GQIVKYQPGINEAAKAMLRELSKLDSSPRLDNFSNS 307          
The following BLAST results are available for this feature:
BLAST of CB417311 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
HSFA2_ARATH4.332e-6556.76Heat stress transcription factor A-2 OS=Arabidopsi... [more]
HSF30_SOLPE4.332e-6556.36Heat shock factor protein HSF30 OS=Solanum peruvia... [more]
HFA2C_ORYSJ7.665e-5449.77Heat stress transcription factor A-2c OS=Oryza sat... [more]
HFA2B_ORYSJ9.369e-5255.56Heat stress transcription factor A-2b OS=Oryza sat... [more]
HFA2E_ORYSJ1.036e-5055.56Heat stress transcription factor A-2e OS=Oryza sat... [more]
HFA2A_ORYSJ5.141e-5058.19Heat stress transcription factor A-2a OS=Oryza sat... [more]
HFA6B_ARATH2.552e-4955.03Heat stress transcription factor A-6b OS=Arabidops... [more]
HSFA1_ORYSJ4.352e-4960.95Heat stress transcription factor A-1 OS=Oryza sati... [more]
HSF8_SOLPE5.684e-4948.32Heat shock factor protein HSF8 OS=Solanum peruvian... [more]
HSF8_SOLLC5.684e-4948.32Heat shock factor protein HSF8 OS=Solanum lycopers... [more]

Pages

back to top
Libraries
Library NameType
Mature peel (flavedo) cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0387 Mature peel (flavedo) cDNA subtraction library Citrus sinensis cDNA clone 6P032 similar to heat shock transcription factor (acc# CAA09300), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB417311 ID=CB417311|Name=CB417311|organism=Citrus sinensis|type=EST|length=683bp
GCTTCCGAAATATTTCAAGCACAGTAATTTTTCTAGCTTCATTCGCCAGC
TCAACACTTATGGTTTTAGAAAGGTTGATCCTGATAGATGGGAATTTGCC
AATGAAGGATTTTTGGGAGGGCAGAAGCATCTACTGAAAACAATCAAGAG
AAGGCGACACGTCTCACAGAGTATGCAACAGCGAGGAGGAGAAGCTTGTC
TTGAGGTGGGACAATATGGACTGGATGGTGAGCTTGAAAGATTAAAGAGG
GACCGAAATGTGTTGATGGCAGAAATTGTTAGGCTGAGGCAACATCAGCA
GCAATCAAGAGATCAACTCAGTGCAATGGAGGATAGGTTATTAAGCACAG
AAAAGAAGCAGCAGCAGATGATGACATTCCTTGCAAAAGCACTCAAAAAC
CCATCGTTTTTCCAGCAATTAGTTCAGAGTAATGCACACAGAAGAGAACT
GGGAGGTGTTCAAACTGGGAGAAAGCGGAGACTAACGGCCACACCAAGCA
TGGAGAACTTACAAGAAACAATTTCCGTGGCACCTGTGGGTCTGGATTGT
GGTCCGGTTGTAGATTACACAGTCCAAGATCAAAATGAATTGACCTCCAT
GGAAACTGAGATAGAGACGTTTCTTTCTTCGCCGGTGGACAACGAATCAA
GCAGTGATATCGACAACCCAAATGCTGGTTCAG
back to top