CB417314

Overview
NameCB417314
Unique NameCB417314
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length281
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13774 contig Csv1_Contig13774:882..1162. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPEB_ARATH (Vacuolar-processing enzyme beta-isozyme OS=Arabidopsis thaliana GN=At1g62710 PE=2 SV=3)

HSP 1 Score: 151.754 bits (382), Expect = 1.030e-36
Identity = 71/94 (75.53%), Postives = 80/94 (85.11%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTNFPPNKLQ-PDQMGVVNQRDADLLFMWHM 281
            SVAWMEDSETHNLK+ETI QQY  VK RTSN+N Y+ GSHVMEYGN S+KSEKLYLYQGFDPA+ N P N+L    ++GVVNQRDADLLF+WHM
Sbjct:  264 SVAWMEDSETHNLKKETIKQQYHTVKMRTSNYNTYSGGSHVMEYGNNSIKSEKLYLYQGFDPATVNLPLNELPVKSKIGVVNQRDADLLFLWHM 357          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPE_RICCO (Vacuolar-processing enzyme OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.048e-33
Identity = 64/94 (68.09%), Postives = 78/94 (82.98%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTNFPPNKLQPD-QMGVVNQRDADLLFMWHM 281
            SVAWMEDSE+HNLK+ET+ QQY +VK RTSN+N Y +GSHVM+YGN S+K++KLYL+QGFDPAS NFPPN    +  M VVNQRDA+L FMW +
Sbjct:  275 SVAWMEDSESHNLKKETVKQQYSSVKARTSNYNTYAAGSHVMQYGNQSIKADKLYLFQGFDPASVNFPPNNAHLNAPMEVVNQRDAELHFMWQL 368          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPE_SOYBN (Vacuolar-processing enzyme OS=Glycine max PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.287e-33
Identity = 64/94 (68.09%), Postives = 78/94 (82.98%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTNFPP-NKLQPDQMGVVNQRDADLLFMWHM 281
            SVAWMEDSE HNLKRE++ QQY++VK+RTSNFNNY  GSHVM+YG+T++ +EKLYLYQGFDPA+ NFPP N     +M VVNQRDA+L  +W M
Sbjct:  273 SVAWMEDSEAHNLKRESVKQQYKSVKQRTSNFNNYAMGSHVMQYGDTNITAEKLYLYQGFDPATVNFPPQNGRLETKMEVVNQRDAELFLLWQM 366          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: LEGU_CANEN (Legumain OS=Canavalia ensiformis PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.287e-33
Identity = 65/94 (69.15%), Postives = 79/94 (84.04%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTNFPP-NKLQPDQMGVVNQRDADLLFMWHM 281
            SV+WMEDSETHNLKRET+ QQYQ+V++RTSN N+Y  GSHVM+YG+T++ +EKLYLY GFDPA+ NFPP N     +M VVNQRDA+LLFMW M
Sbjct:  253 SVSWMEDSETHNLKRETVQQQYQSVRKRTSNSNSYRFGSHVMQYGDTNITAEKLYLYHGFDPATVNFPPHNGNLEAKMEVVNQRDAELLFMWQM 346          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPE2_PHAVU (Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.221e-31
Identity = 62/94 (65.96%), Postives = 77/94 (81.91%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTNFPP-NKLQPDQMGVVNQRDADLLFMWHM 281
            SVAWMEDSE+HNLK+E++ QQYQ+VK+RTSNF  Y  GSHVM+YG+ ++ +EKLYLY GFDPA+ NFPP N     +M VVNQRDA+LLFMW +
Sbjct:  271 SVAWMEDSESHNLKKESVEQQYQSVKQRTSNFEAYAMGSHVMQYGDANMTAEKLYLYHGFDPATVNFPPHNGRLKSKMEVVNQRDAELLFMWQV 364          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPE_CITSI (Vacuolar-processing enzyme OS=Citrus sinensis PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.144e-19
Identity = 47/94 (50.00%), Postives = 64/94 (68.09%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTNF---PPNKLQPDQMGVVNQRDADLLFMW 275
            S+AWMEDS+ HNL+ ET+ QQY+ VK RT+++N+Y  GSHVM+YG+  +    L+ Y G +PA+ N+     N L+P     VNQRDADLL  W
Sbjct:  273 SIAWMEDSDIHNLRTETLHQQYELVKTRTASYNSY--GSHVMQYGDIGLSKNNLFTYLGTNPANDNYTFVDENSLRPASK-AVNQRDADLLHFW 363          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPEA_ARATH (Vacuolar-processing enzyme alpha-isozyme OS=Arabidopsis thaliana GN=At2g25940 PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 7.412e-19
Identity = 47/95 (49.47%), Postives = 64/95 (67.37%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTNFP---PNKLQPDQMGVVNQRDADLLFMWH 278
            SVAW+EDSE HNL+ ET+ +QY+ VK+RT+  +  + GSHVME+G+  +  EKL L+ G +PA  NF     N ++P    V NQRDADL+  WH
Sbjct:  257 SVAWIEDSEKHNLQTETLHEQYELVKKRTAG-SGKSYGSHVMEFGDIGLSKEKLVLFMGTNPADENFTFVNENSIRPPSR-VTNQRDADLVHFWH 349          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPEG_ARATH (Vacuolar-processing enzyme gamma-isozyme OS=Arabidopsis thaliana GN=At4g32940 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.651e-18
Identity = 48/94 (51.06%), Postives = 61/94 (64.89%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTNF---PPNKLQPDQMGVVNQRDADLLFMW 275
            SVAWMEDS  HNL+ ET+ QQY+ VK RT+    Y+ GSHVM+YG+  +  + L LY G +PA+ NF     N L+P    V NQRDADL+  W
Sbjct:  272 SVAWMEDSGMHNLQTETLHQQYELVKRRTAPV-GYSYGSHVMQYGDVGISKDNLDLYMGTNPANDNFTFADANSLKPPSR-VTNQRDADLVHFW 363          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPE1_PHAVU (Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.061e-17
Identity = 46/93 (49.46%), Postives = 58/93 (62.37%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTN--FPPNKLQPDQMGVVNQRDADLLFMW 275
            SVAWMEDS+ HNL+ ET+ QQY+ VKERT +   Y  GSHVM+YG+  +  + L+ Y G DPA+ N  F            VNQRDADL+  W
Sbjct:  262 SVAWMEDSDRHNLRTETLHQQYKLVKERTISGGLY-YGSHVMQYGDVGLSKDILFHYLGTDPANENLTFVDENSLWSSSKAVNQRDADLVHFW 353          
BLAST of CB417314 vs. ExPASy Swiss-Prot
Match: VPE_VICSA (Vacuolar-processing enzyme OS=Vicia sativa PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.494e-15
Identity = 45/97 (46.39%), Postives = 57/97 (58.76%), Query Frame = 3
Query:    3 SVAWMEDSETHNLKRETISQQYQAVKERTSNFNNYNSGSHVMEYGNTSVKSEKLYLYQGFDPASTN-----FPPNKLQ-PDQMGVVNQRDADLLFMW 275
            S+AWMEDSE HNL+ E++ QQY+ VK RT    +   GSHVMEYG+  +    LY Y G +PA+ N        N L+       VNQRDADL+  W
Sbjct:  269 SIAWMEDSEVHNLQTESLQQQYKLVKNRTI---SEPYGSHVMEYGDIGLSKNDLYQYLGTNPANDNNSFVDETENSLKLRTPSAAVNQRDADLIHFW 362          
The following BLAST results are available for this feature:
BLAST of CB417314 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
VPEB_ARATH1.030e-3675.53Vacuolar-processing enzyme beta-isozyme OS=Arabido... [more]
VPE_RICCO4.048e-3368.09Vacuolar-processing enzyme OS=Ricinus communis PE=... [more]
VPE_SOYBN5.287e-3368.09Vacuolar-processing enzyme OS=Glycine max PE=2 SV=... [more]
LEGU_CANEN5.287e-3369.15Legumain OS=Canavalia ensiformis PE=1 SV=1[more]
VPE2_PHAVU2.221e-3165.96Vacuolar-processing enzyme OS=Phaseolus vulgaris P... [more]
VPE_CITSI1.144e-1950.00Vacuolar-processing enzyme OS=Citrus sinensis PE=2... [more]
VPEA_ARATH7.412e-1949.47Vacuolar-processing enzyme alpha-isozyme OS=Arabid... [more]
VPEG_ARATH1.651e-1851.06Vacuolar-processing enzyme gamma-isozyme OS=Arabid... [more]
VPE1_PHAVU9.061e-1749.46Vacuolar-processing enzyme OS=Phaseolus vulgaris P... [more]
VPE_VICSA6.494e-1546.39Vacuolar-processing enzyme OS=Vicia sativa PE=1 SV... [more]
back to top
Libraries
Library NameType
Mature peel (flavedo) cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0390 Mature peel (flavedo) cDNA subtraction library Citrus sinensis cDNA clone 6P035 similar to asparaginyl endopeptidase (acc# AAF89679), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB417314 ID=CB417314|Name=CB417314|organism=Citrus sinensis|type=EST|length=281bp
ACAGTGTTGCTTGGATGGAGGACAGTGAGACTCACAATTTGAAGAGAGAG
ACCATAAGCCAACAGTATCAAGCTGTGAAGGAACGGACTTCCAATTTTAA
CAATTACAATTCTGGATCTCATGTGATGGAATATGGGAACACAAGCGTCA
AATCAGAGAAGCTATACTTGTATCAAGGTTTCGATCCTGCCAGCACCAAC
TTTCCTCCGAACAAGCTTCAGCCTGATCAAATGGGAGTTGTCAACCAGAG
AGACGCAGATCTTCTCTTCATGTGGCATATG
back to top