CF417071

Overview
NameCF417071
Unique NameCF417071
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length662
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF417071_ssr538 microsatellite CF417071_ssr538:538..553. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10454 contig Csv1_Contig10454:381..1040. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.378e-73
Identity = 125/144 (86.81%), Postives = 135/144 (93.75%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            NNALPNNAGGWCNPPQQHFDLSQPVFQ IAQYRAG+VPVAYRRVPC RRGGIRFTINGHSYFNLVLITNVGGAGDVH+  +KGSRTGWQ MSRNWGQNWQSN+YLNGQSLSF+VTTSDG+T+ S NVA AGWSFG+T++GAQ R
Sbjct:  107 NNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAMVKGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGQTIVSNNVANAGWSFGQTFTGAQLR 250          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.443e-70
Identity = 119/144 (82.64%), Postives = 133/144 (92.36%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            NNAL NN GGWCNPP +HFDL+QPVFQ IAQYRAG+VPV+YRRVPC RRGGIRFTINGHSYFNLVLITNVGGAGDVH+ +IKGSRT WQ MSRNWGQNWQSN+YLNGQ+LSF+VTTSDGRTV S+N APAGWS+G+T++G QFR
Sbjct:  106 NNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQNWQSNSYLNGQALSFKVTTSDGRTVVSFNAAPAGWSYGQTFAGGQFR 249          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 263.848 bits (673), Expect = 5.483e-70
Identity = 119/144 (82.64%), Postives = 131/144 (90.97%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            NNALPNNAGGWCNPP  HFDLSQPVFQ IAQY+AGVVPV+YRRVPC RRGGIRFTINGHSYFNLVL+TNVGGAGDVH+V++KGSRT WQ MSRNWGQNWQSN  LNGQ+LSF+VT SDGRTV S N+APA WSFG+T++G QFR
Sbjct:  110 NNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPASWSFGQTFTGRQFR 253          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSJ (Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.636e-64
Identity = 106/143 (74.13%), Postives = 126/143 (88.11%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            N  LP++ GGWCNPP+ HFD+++P F HIAQYRAG+VPV++RRVPC ++GG+RFT+NGHSYFNLVL+TNV GAGDV +VSIKGSRTGWQPMSRNWGQNWQSN +L+GQSLSF+VT SDGRTVTS NVA  GW FG+T+ G QF
Sbjct:  104 NYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF 246          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSI (Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.636e-64
Identity = 106/143 (74.13%), Postives = 126/143 (88.11%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            N  LP++ GGWCNPP+ HFD+++P F HIAQYRAG+VPV++RRVPC ++GG+RFT+NGHSYFNLVL+TNV GAGDV +VSIKGSRTGWQPMSRNWGQNWQSN +L+GQSLSF+VT SDGRTVTS NVA  GW FG+T+ G QF
Sbjct:  104 NYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF 246          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 243.047 bits (619), Expect = 1.002e-63
Identity = 107/143 (74.83%), Postives = 123/143 (86.01%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            N ALPN+ GGWCNPP+ HFD+++P F  I  YRAG+VPV+YRRVPC ++GGIRFTINGHSYFNLVL+TNV G GDV +VSIKGS TGWQPMSRNWGQNWQSN+YL+GQSLSF+V  SDGRTVTS NV PAGW FG+T+ G QF
Sbjct:  109 NYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMSRNWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGWQFGQTFEGGQF 251          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA8_ARATH (Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 2.467e-62
Identity = 108/144 (75.00%), Postives = 125/144 (86.81%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRT-GWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            N  L N+ GGWCNPP QHFDL++P F  IAQYRAG+VPV++RRVPC ++GGIRFTINGHSYFNLVLI+NVGGAGDVHAVSIKGS+T  WQ MSRNWGQNWQSN+Y+N QSLSF+VTTSDGRT+ S +VAP+ W FG+TY G QF
Sbjct:  110 NPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTQSWQAMSRNWGQNWQSNSYMNDQSLSFQVTTSDGRTLVSNDVAPSNWQFGQTYQGGQF 253          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP14_ARATH (Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 5.495e-62
Identity = 110/144 (76.39%), Postives = 121/144 (84.03%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            N A  NNAGGWCNPPQ HFDL+QP+F  IAQY+AGVVPV YRRV C R+GGIRFTINGHSYFNLVLITNV GAGDV +VSIKG+ T WQ MSRNWGQNWQSN  L+GQ+LSF+VTTSDGRTV S N  P  WSFG+TY+G QFR
Sbjct:  109 NFAQANNAGGWCNPPQHHFDLAQPIFLRIAQYKAGVVPVQYRRVACRRKGGIRFTINGHSYFNLVLITNVAGAGDVISVSIKGTNTRWQSMSRNWGQNWQSNAKLDGQALSFKVTTSDGRTVISNNATPRNWSFGQTYTGKQFR 252          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA5_ORYSJ (Expansin-A5 OS=Oryza sativa subsp. japonica GN=EXPA5 PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 3.938e-60
Identity = 103/144 (71.53%), Postives = 123/144 (85.42%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRT-GWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQF 430
            NNALP++ GGWCNPP+ HFD+SQPVFQ IA ++AG+VPV+YRRV C ++GGIRFTINGHSYFNLVL+TNVGGAGDVHAV++K  R+  WQ +SRNWGQNWQS   L+GQ+LSF VTT DGR+V S N  P GWSFG+T+SGAQF
Sbjct:  147 NNALPSDDGGWCNPPRAHFDMSQPVFQRIALFKAGIVPVSYRRVACQKKGGIRFTINGHSYFNLVLVTNVGGAGDVHAVAVKSERSAAWQALSRNWGQNWQSAALLDGQALSFRVTTGDGRSVVSNNAVPRGWSFGQTFSGAQF 290          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA5_ARATH (Expansin-A5 OS=Arabidopsis thaliana GN=EXPA5 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.955e-59
Identity = 103/136 (75.74%), Postives = 119/136 (87.50%), Query Frame = 2
Query:   26 GGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            GG C+PP  HFDLSQP+++ IA Y++G++PV YRRV C R GGIRFTINGHSYFNLVL+TNVGGAGDVH+VS+KGSRT WQ MSRNWGQNWQSN+YLNGQSLSF VTTSD R+V S+NVAP  WSFG+TY+G QFR
Sbjct:  119 GGACDPPNHHFDLSQPIYEKIALYKSGIIPVMYRRVRCKRSGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSMKGSRTKWQLMSRNWGQNWQSNSYLNGQSLSFVVTTSDRRSVVSFNVAPPTWSFGQTYTGGQFR 254          
The following BLAST results are available for this feature:
BLAST of CF417071 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
EXPA1_ARATH2.378e-7386.81Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXP10_ARATH1.443e-7082.64Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]
EXP15_ARATH5.483e-7082.64Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXPA4_ORYSJ2.636e-6474.13Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ORYSI2.636e-6474.13Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4... [more]
EXPA2_ORYSJ1.002e-6374.83Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA8_ARATH2.467e-6275.00Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 ... [more]
EXP14_ARATH5.495e-6276.39Expansin-A14 OS=Arabidopsis thaliana GN=EXPA14 PE=... [more]
EXPA5_ORYSJ3.938e-6071.53Expansin-A5 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA5_ARATH1.955e-5975.74Expansin-A5 OS=Arabidopsis thaliana GN=EXPA5 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-001 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-001_A1 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417071 ID=CF417071|Name=CF417071|organism=Citrus sinensis|type=EST|length=662bp
GAACAACGCCCTTCCCAACAATGCAGGCGGTTGGTGCAATCCTCCGCAGC
AACATTTTGATCTCTCTCAGCCTGTGTTCCAACACATTGCTCAATACAGA
GCTGGAGTTGTCCCTGTAGCTTACAGGAGGGTACCCTGCGGAAGAAGGGG
AGGCATCAGGTTCACAATCAATGGCCATTCCTACTTCAACCTAGTGTTGA
TCACCAACGTTGGTGGTGCTGGTGATGTTCATGCTGTTTCAATCAAAGGA
TCTAGAACTGGCTGGCAGCCAATGTCAAGAAACTGGGGCCAAAACTGGCA
AAGCAACACTTATCTCAATGGCCAAAGCCTGTCATTTGAGGTCACCACAA
GCGATGGCCGTACTGTGACTTCCTACAATGTTGCCCCTGCTGGCTGGTCC
TTTGGCCGAACTTACTCCGGTGCTCAATTCCGCTAGAGCCACCAAGACCA
TTAGNAGATTGGGTTTTAACACCTTTTTTAGCTATATATTCGTGTACTAA
GTAGTATATTTTAGTATGAAATTTTAGCATACTAGGGTATATATATATAT
ATATNAATATAGAAGTAGCTATGTGGCTAGTTTTTGGCTTCCAGGGTCAA
AAATGAAAAAAAAGGGCTTATTTTAAAATGGCTTATTTTTTTCATTTTCA
TTGATTTTTATG
back to top