CF417077

Overview
NameCF417077
Unique NameCF417077
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig242 contig Csv1_Contig242:6..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL102_ARATH (60S ribosomal protein L10-2 OS=Arabidopsis thaliana GN=RPL10B PE=2 SV=2)

HSP 1 Score: 240.736 bits (613), Expect = 3.677e-101
Identity = 112/122 (91.80%), Postives = 116/122 (95.08%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWKA 413
            MGRRPARCYRQIK KPYPKSR+CRGVPDPKIRIYDVGMK+KGVDEFP+CVHLVSWEKENVSSEALEAARIACNKYM K AGKDAFHLR+RVHPFHVLRINKMLSCAGADRLQTGM G F KA
Sbjct:    1 MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPYCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKA 122          

HSP 2 Score: 149.058 bits (375), Expect = 3.677e-101
Identity = 74/102 (72.55%), Postives = 81/102 (79.41%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWCECXAFSGCHGPLAQRPPGRAFL 699
            RGAFGK  GTCARVAIGQVLLSVRCKD++ HHAQEALRRAKFKFPGRQKIIVSRKWGFTKF+RADY ++   ++  P       F  CHGPLA R PG AFL
Sbjct:  116 RGAFGKALGTCARVAIGQVLLSVRCKDAHGHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADYTKLRQEKRIVPDGVNA-KFLSCHGPLANRQPGSAFL 216          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL101_ARATH (60S ribosomal protein L10-1 OS=Arabidopsis thaliana GN=RPL10A PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 4.797e-101
Identity = 113/122 (92.62%), Postives = 116/122 (95.08%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWKA 413
            MGRRPARCYRQIK KPYPKSR+CRGVPDPKIRIYDVGMK+KGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYM K AGKDAFHLR+RVHPFHVLRINKMLSCAGADRLQTGM G F KA
Sbjct:    1 MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKA 122          

HSP 2 Score: 147.517 bits (371), Expect = 4.797e-101
Identity = 73/102 (71.57%), Postives = 81/102 (79.41%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWCECXAFSGCHGPLAQRPPGRAFL 699
            RGAFGK  GTCARVAIGQVLLSVRCKD++ HHAQEALRRAKFKFPGRQKIIVSRKWGFTKF+RAD+ ++   ++  P       F  CHGPLA R PG AFL
Sbjct:  116 RGAFGKALGTCARVAIGQVLLSVRCKDAHGHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADFTKLRQEKRVVPDGVNA-KFLSCHGPLANRQPGSAFL 216          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL103_ARATH (60S ribosomal protein L10-3 OS=Arabidopsis thaliana GN=RPL10C PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.174e-98
Identity = 113/122 (92.62%), Postives = 116/122 (95.08%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWKA 413
            MGRRPARCYRQIK KPYPKSR+CRGVPDPKIRIYDVGMK+KGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYM K AGKDAFHLR+RVHPFHVLRINKMLSCAGADRLQTGM G F KA
Sbjct:    1 MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKA 122          

HSP 2 Score: 138.658 bits (348), Expect = 2.174e-98
Identity = 70/102 (68.63%), Postives = 79/102 (77.45%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWCECXAFSGCHGPLAQRPPGRAFL 699
            RGAFGK  GTCARVAIGQVLLSVRCKD++  HAQEALRRAKFKFPGRQKIIVSRKWGFTKF+RA+Y ++   ++  P        S  HGPLA R PG AF+
Sbjct:  116 RGAFGKALGTCARVAIGQVLLSVRCKDNHGVHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRAEYTKLRAMKRIVPDGVNAKFLSN-HGPLANRQPGSAFI 216          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL10_DROME (60S ribosomal protein L10 OS=Drosophila melanogaster GN=Qm PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 7.018e-76
Identity = 94/121 (77.69%), Postives = 104/121 (85.95%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWK 410
            MGRRPARCYR  KNKPYPKSRFCRGVPDPKIRI+D+G KK  V++FP CVHLVS E E +SSEALEA RI CNKY+ KY GKD FH+R+R+HPFHV+RINKMLSCAGADRLQTGM G F K
Sbjct:    1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGK 121          

HSP 2 Score: 99.7525 bits (247), Expect = 7.018e-76
Identity = 53/93 (56.99%), Postives = 61/93 (65.59%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWCECXAFSGCHGPLA 672
            RGAFGKPQGT ARV IGQ ++SVR  D       EALRRAKFKFPGRQKI VS+KWGFTK+ R  Y E+    +  P  C    +   HGP+A
Sbjct:  116 RGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCN-VKYRPEHGPIA 207          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL10L_MACFA (60S ribosomal protein L10-like OS=Macaca fascicularis GN=RPL10L PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 7.665e-75
Identity = 93/121 (76.86%), Postives = 101/121 (83.47%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWK 410
            MGRRPARCYR  KNKPYPKSRFCRGVPD KIRI+D+G KK  VDEFP C H+VS E E +SSEALEAARI  NKYM K  G+D FH+RVR+HPFHV+RINKMLSCAGADRLQTGM G F K
Sbjct:    1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGRDGFHMRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGK 121          

HSP 2 Score: 103.99 bits (258), Expect = 7.665e-75
Identity = 52/92 (56.52%), Postives = 65/92 (70.65%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWCECXAFSGCHGPL 669
            RGAFGKPQGT ARV IGQV++S+R K  N  H  EALRRAKFKFPGRQKI +S+KWGFTKF+  ++ ++   ++  P  C    +   HGPL
Sbjct:  116 RGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAKKRLIPDGCG-VKYVPSHGPL 206          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL10_RAT (60S ribosomal protein L10 OS=Rattus norvegicus GN=Rpl10 PE=1 SV=3)

HSP 1 Score: 199.134 bits (505), Expect = 2.218e-74
Identity = 94/121 (77.69%), Postives = 101/121 (83.47%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWK 410
            MGRRPARCYR  KNKPYPKSRFCRGVPD KIRI+D+G KK  VDEFP C H+VS E E +SSEALEAARI  NKYM K  GKD FH+RVR+HPFHV+RINKMLSCAGADRLQTGM G F K
Sbjct:    1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGK 121          

HSP 2 Score: 101.293 bits (251), Expect = 2.218e-74
Identity = 48/80 (60.00%), Postives = 60/80 (75.00%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWC 633
            RGAFGKPQGT ARV IGQV++S+R K  N  H  EALRRAKFKFPGRQKI +S+KWGFTKF+  ++ ++   ++  P  C
Sbjct:  116 RGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGC 195          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL10_PONAB (60S ribosomal protein L10 OS=Pongo abelii GN=RPL10 PE=2 SV=3)

HSP 1 Score: 199.134 bits (505), Expect = 2.218e-74
Identity = 94/121 (77.69%), Postives = 101/121 (83.47%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWK 410
            MGRRPARCYR  KNKPYPKSRFCRGVPD KIRI+D+G KK  VDEFP C H+VS E E +SSEALEAARI  NKYM K  GKD FH+RVR+HPFHV+RINKMLSCAGADRLQTGM G F K
Sbjct:    1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGK 121          

HSP 2 Score: 101.293 bits (251), Expect = 2.218e-74
Identity = 48/80 (60.00%), Postives = 60/80 (75.00%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWC 633
            RGAFGKPQGT ARV IGQV++S+R K  N  H  EALRRAKFKFPGRQKI +S+KWGFTKF+  ++ ++   ++  P  C
Sbjct:  116 RGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGC 195          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL10_PAPAN (60S ribosomal protein L10 OS=Papio anubis GN=RPL10 PE=3 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 2.218e-74
Identity = 94/121 (77.69%), Postives = 101/121 (83.47%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWK 410
            MGRRPARCYR  KNKPYPKSRFCRGVPD KIRI+D+G KK  VDEFP C H+VS E E +SSEALEAARI  NKYM K  GKD FH+RVR+HPFHV+RINKMLSCAGADRLQTGM G F K
Sbjct:    1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGK 121          

HSP 2 Score: 101.293 bits (251), Expect = 2.218e-74
Identity = 48/80 (60.00%), Postives = 60/80 (75.00%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWC 633
            RGAFGKPQGT ARV IGQV++S+R K  N  H  EALRRAKFKFPGRQKI +S+KWGFTKF+  ++ ++   ++  P  C
Sbjct:  116 RGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGC 195          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL10_MOUSE (60S ribosomal protein L10 OS=Mus musculus GN=Rpl10 PE=2 SV=3)

HSP 1 Score: 199.134 bits (505), Expect = 2.218e-74
Identity = 94/121 (77.69%), Postives = 101/121 (83.47%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWK 410
            MGRRPARCYR  KNKPYPKSRFCRGVPD KIRI+D+G KK  VDEFP C H+VS E E +SSEALEAARI  NKYM K  GKD FH+RVR+HPFHV+RINKMLSCAGADRLQTGM G F K
Sbjct:    1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGK 121          

HSP 2 Score: 101.293 bits (251), Expect = 2.218e-74
Identity = 48/80 (60.00%), Postives = 60/80 (75.00%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWC 633
            RGAFGKPQGT ARV IGQV++S+R K  N  H  EALRRAKFKFPGRQKI +S+KWGFTKF+  ++ ++   ++  P  C
Sbjct:  116 RGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGC 195          
BLAST of CF417077 vs. ExPASy Swiss-Prot
Match: RL10_HUMAN (60S ribosomal protein L10 OS=Homo sapiens GN=RPL10 PE=1 SV=4)

HSP 1 Score: 199.134 bits (505), Expect = 2.218e-74
Identity = 94/121 (77.69%), Postives = 101/121 (83.47%), Query Frame = 3
Query:   48 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKYAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMEGCFWK 410
            MGRRPARCYR  KNKPYPKSRFCRGVPD KIRI+D+G KK  VDEFP C H+VS E E +SSEALEAARI  NKYM K  GKD FH+RVR+HPFHV+RINKMLSCAGADRLQTGM G F K
Sbjct:    1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGK 121          

HSP 2 Score: 101.293 bits (251), Expect = 2.218e-74
Identity = 48/80 (60.00%), Postives = 60/80 (75.00%), Query Frame = 1
Query:  394 RGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLEVEVGEQDCPXWC 633
            RGAFGKPQGT ARV IGQV++S+R K  N  H  EALRRAKFKFPGRQKI +S+KWGFTKF+  ++ ++   ++  P  C
Sbjct:  116 RGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGC 195          
The following BLAST results are available for this feature:
BLAST of CF417077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
RL102_ARATH3.677e-10191.8060S ribosomal protein L10-2 OS=Arabidopsis thalian... [more]
RL101_ARATH4.797e-10192.6260S ribosomal protein L10-1 OS=Arabidopsis thalian... [more]
RL103_ARATH2.174e-9892.6260S ribosomal protein L10-3 OS=Arabidopsis thalian... [more]
RL10_DROME7.018e-7677.6960S ribosomal protein L10 OS=Drosophila melanogast... [more]
RL10L_MACFA7.665e-7576.8660S ribosomal protein L10-like OS=Macaca fascicula... [more]
RL10_RAT2.218e-7477.6960S ribosomal protein L10 OS=Rattus norvegicus GN=... [more]
RL10_PONAB2.218e-7477.6960S ribosomal protein L10 OS=Pongo abelii GN=RPL10... [more]
RL10_PAPAN2.218e-7477.6960S ribosomal protein L10 OS=Papio anubis GN=RPL10... [more]
RL10_MOUSE2.218e-7477.6960S ribosomal protein L10 OS=Mus musculus GN=Rpl10... [more]
RL10_HUMAN2.218e-7477.6960S ribosomal protein L10 OS=Homo sapiens GN=RPL10... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-007 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-001_A10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417077 ID=CF417077|Name=CF417077|organism=Citrus sinensis|type=EST|length=703bp
GCCGAGCAGAAAGAGAGAATAGCTGAGACCGAACACGAACGCTCGCCATG
GGAAGAAGACCGGCAAGGTGTTACCGCCAAATCAAGAACAAACCCTACCC
AAAGTCCCGCTTTTGCCGCGGTGTCCCCGATCCCAAGATCAGAATCTACG
ATGTCGGGATGAAGAAGAAAGGCGTCGACGAGTTCCCCTTCTGCGTTCAC
CTCGTCAGTTGGGAGAAGGAGAACGTGTCGAGCGAGGCCTTGGAAGCTGC
CCGTATCGCTTGCAACAAGTACATGGCCAAGTACGCTGGCAAGGATGCTT
TCCATTTGCGAGTGAGGGTGCACCCCTTCCATGTTCTGCGCATTAACAAG
ATGCTTTCGTGTGCTGGGGCTGATCGGCTCCAGACTGGAATGGAGGGGTG
CTTTTGGAAAGCCCCAAGGAACCTGTGCTCGTGTTGCTATCGGGCAGGTC
TTGCTTTCTGTCCGTTGCAAGGACAGTAACAGCCACCATGCTCAGGAGGC
CCTTCGCCGTGCTAAGTTCAAGTTTCCTGGTCGTCAAAAGATTATTGTCA
GCAGGAAATGGGGATTTACCAAGTTCAGCCGTGCTGATTATCTNGAGGTG
GAAGTCGGAGAACAGGATTGTCCCNGATGGTGTGAATGCCNAGCNTTCTC
NGGATGTCATGGTCCTTTGGCTCAACGCCCACCTGGAAGAGCTTTCCTGG
AAG
back to top