CF417086

Overview
NameCF417086
Unique NameCF417086
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length643
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF417086 vs. ExPASy Swiss-Prot
Match: APL_ARATH (Myb family transcription factor APL OS=Arabidopsis thaliana GN=APL PE=2 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 5.870e-29
Identity = 70/121 (57.85%), Postives = 83/121 (68.60%), Query Frame = 2
Query:   20 KQHPSTIMRTMGVKGLTLYHLKSHLQKYRLGKQACKETTENSKDVSCVAESQDXXXXXXXXXRMVAQDPNDGYQVTEALRVQMEVQRRLHEQLEVQRRLQLRIEAQGKYLQSILEKACKAL 382
            K  P TIMR MGVKGLTLYHLKSHLQK+RLGKQ  KE  ++S      A + D          M++++ N+         +QMEVQRRLHEQLEVQR LQLRIEAQGKY+QSILE+AC+ L
Sbjct:   59 KATPKTIMRVMGVKGLTLYHLKSHLQKFRLGKQPHKEYGDHSTKEGSRASAMDIQRNVASSSGMMSRNMNE---------MQMEVQRRLHEQLEVQRHLQLRIEAQGKYMQSILERACQTL 170          
The following BLAST results are available for this feature:
BLAST of CF417086 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
APL_ARATH5.870e-2957.85Myb family transcription factor APL OS=Arabidopsis... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-016 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-001_B8 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417086 ID=CF417086|Name=CF417086|organism=Citrus sinensis|type=EST|length=643bp
AGCTCGGTGGCCCCTGACAAAGCAACACCCAAGTACTATCATGAGAACGA
TGGGAGTGAAAGGCCTTACCCTTTATCATCTCAAATCACATCTTCAGAAG
TACCGCTTGGGAAAGCAAGCGTGCAAGGAAACGACAGAGAACTCCAAGGA
TGTTTCTTGTGTTGCTGAAAGTCAGGACACTGGTTCATCAACAACATCGT
CAACCAGAATGGTAGCGCAAGATCCAAATGATGGTTACCAGGTTACTGAG
GCTTTGCGAGTACAGATGGAAGTCCAACGAAGGCTTCATGAGCAGCTGGA
GGTTCAGCGACGGCTCCAACTCCGAATTGAAGCGCAAGGCAAATACCTAC
AGTCAATACTTGAGAAAGCTTGTAAAGCTCTGAATGATCAGGCCATCGTG
GCTGCTGGGCTTGAAGCTGCTAGAGAGGAGCTTTCCGAACTTGCCATCAA
AGTTTCCAATGATTGTCAAGGGATGGTCCCTCTGGAGAACATAAAAATGC
CATCCATATCTGAACTTGCTGCAGCTCTAGAGAGCAAGAATGCTTCCACT
ATACCAGTTCGAATCGGTGACTGTTCTGTTGAAAGTTGCTTGACTTCAAC
CAGTAGTCCAGTGTCCCCAATGGGTCTGGGTTCACAGGCTGCT
back to top