CF417087

Overview
NameCF417087
Unique NameCF417087
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length485
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 3.248e-13
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 3
Query:   15 QVTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLETSLRN 179
            QV++SL PCI +L+ GG   P  CC GV+SLN A       R+AACNCL+++  +
Sbjct:    5 QVSSSLAPCINYLRAGG-VVPANCCNGVRSLNNA-AKTTADRQAACNCLKSAFNS 57          

HSP 2 Score: 44.2838 bits (103), Expect = 3.248e-13
Identity = 18/32 (56.25%), Postives = 24/32 (75.00%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXISP 258
            K A+ +I+G+  N+AAGLP  CGV +PY ISP
Sbjct:   52 KSAFNSIKGLNLNLAAGLPGKCGVSVPYKISP 83          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 6.808e-13
Identity = 27/52 (51.92%), Postives = 35/52 (67.31%), Query Frame = 3
Query:   15 QVTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLETS 170
            QV++SL PCI +L  GG   PP CC GV+SLN A     P R+AAC CL+++
Sbjct:   30 QVSSSLAPCISYLTKGGAV-PPACCSGVKSLNSA-AKTTPDRQAACGCLKSA 79          

HSP 2 Score: 38.5058 bits (88), Expect = 6.808e-13
Identity = 17/32 (53.12%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXISP 258
            K AY +I G+    AA  P  CGV IPY ISP
Sbjct:   77 KSAYNSISGVNAGNAASFPGKCGVSIPYKISP 108          

HSP 3 Score: 21.1718 bits (43), Expect = 6.808e-13
Identity = 7/10 (70.00%), Postives = 10/10 (100.00%), Query Frame = 2
Query:  254 APSTDCSRVR 283
            +PSTDCS+V+
Sbjct:  107 SPSTDCSKVQ 116          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.203e-12
Identity = 23/50 (46.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:   15 QVTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLE 164
            QVT+SL PCI ++++GG   PP CC G++++NG        R+ ACNCL+
Sbjct:   29 QVTSSLAPCIGYVRSGGAV-PPACCNGIRTINGL-ARTTADRQTACNCLK 76          

HSP 2 Score: 42.3578 bits (98), Expect = 1.203e-12
Identity = 18/31 (58.06%), Postives = 21/31 (67.74%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXIS 255
            K   G+I G+ PN AAGLP  CGV +PY IS
Sbjct:   76 KNLAGSISGVNPNNAAGLPGKCGVNVPYKIS 106          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.563e-12
Identity = 23/50 (46.00%), Postives = 35/50 (70.00%), Query Frame = 3
Query:   15 QVTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLE 164
            QV+++L PCIP+++ GG   PP CC G++++N       P R+AACNCL+
Sbjct:   31 QVSSNLAPCIPYVRGGGAV-PPACCNGIRNVNNL-ARTTPDRQAACNCLK 78          

HSP 2 Score: 40.4318 bits (93), Expect = 1.563e-12
Identity = 17/32 (53.12%), Postives = 21/32 (65.62%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXISP 258
            K+   ++ G+ PN AA LP  CGV IPY ISP
Sbjct:   78 KQLSASVPGVNPNNAAALPGKCGVNIPYQISP 109          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 50.447 bits (119), Expect = 5.786e-12
Identity = 23/50 (46.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:   15 QVTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLE 164
            QV++SL PCI +++ GG   PP CC G++++N       P RR ACNCL+
Sbjct:    5 QVSSSLAPCIGYVRGGGAV-PPACCNGIRNVNNL-ARTTPDRRTACNCLK 52          

HSP 2 Score: 40.817 bits (94), Expect = 5.786e-12
Identity = 18/31 (58.06%), Postives = 21/31 (67.74%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXIS 255
            K+  G+I G+ PN AA LP  CGV IPY IS
Sbjct:   52 KQLSGSISGVNPNNAAALPGKCGVNIPYKIS 82          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUPE (Non-specific lipid-transfer protein 1 OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 9.764e-12
Identity = 23/50 (46.00%), Postives = 35/50 (70.00%), Query Frame = 3
Query:   15 QVTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLE 164
            QV+++L PCIP+++ GG   PP CC G++++N       P R+AACNCL+
Sbjct:    5 QVSSALAPCIPYVRGGGAV-PPACCNGIRNVNNL-ARTTPDRQAACNCLK 52          

HSP 2 Score: 37.7354 bits (86), Expect = 9.764e-12
Identity = 16/31 (51.61%), Postives = 20/31 (64.52%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXIS 255
            K+   ++ G+ PN AA LP  CGV IPY IS
Sbjct:   52 KQLSASVPGVNPNNAAALPGKCGVHIPYKIS 82          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.268e-11
Identity = 24/51 (47.06%), Postives = 37/51 (72.55%), Query Frame = 3
Query:   12 AQVTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLE 164
            +QV+A+L PCI ++++GG   PP CC G++++NG      P R+AACNCL+
Sbjct:   28 SQVSANLAPCINYVRSGGAV-PPACCNGIKTINGL-AKTTPDRQAACNCLK 76          

HSP 2 Score: 35.4242 bits (80), Expect = 1.268e-11
Identity = 14/31 (45.16%), Postives = 18/31 (58.06%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXIS 255
            K   G++ G+ P  A  LP  CGV +PY IS
Sbjct:   76 KNLAGSVSGVNPGNAESLPGKCGVNVPYKIS 106          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP2_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 2.740e-11
Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 3
Query:    9 AAQVTASLXPCIPFLK-TGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLETS 170
            + QVT SL PCI +L+ +G    PP CC G++SLN A     P R+AAC C++++
Sbjct:   30 SGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSA-AQTTPVRQAACRCIKSA 83          

HSP 2 Score: 37.7354 bits (86), Expect = 2.740e-11
Identity = 18/32 (56.25%), Postives = 20/32 (62.50%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXISP 258
            K A   I GI   +A+GLP  CGV IPY ISP
Sbjct:   81 KSAAAGITGINFGLASGLPGKCGVNIPYKISP 112          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP4_ARATH (Non-specific lipid-transfer protein 4 OS=Arabidopsis thaliana GN=LTP4 PE=2 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.780e-11
Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 3
Query:   18 VTASLXPCIPFLKTGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLETSLRN-NP 185
            V +SL PC+ +L  GG   PPPCC GV+ LNG      P R+ AC CL+++ +  NP
Sbjct:   30 VASSLSPCLGYLSKGG-VVPPPCCAGVKKLNGM-AQTTPDRQQACRCLQSAAKGVNP 84          

HSP 2 Score: 36.965 bits (84), Expect = 2.780e-11
Identity = 14/24 (58.33%), Postives = 19/24 (79.17%), Query Frame = 1
Query:  184 RGIKPNVAAGLPSXCGVRIPYXIS 255
            +G+ P++A+GLP  CGV IPY IS
Sbjct:   80 KGVNPSLASGLPGKCGVSIPYPIS 103          
BLAST of CF417087 vs. ExPASy Swiss-Prot
Match: NLTP1_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 2.780e-11
Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 3
Query:    9 AAQVTASLXPCIPFLK-TGGRFSPPPCCXGVQSLNGADXNXPPXRRAACNCLETS 170
            + QVT SL PCI +L+ +G    PP CC G++SLN A     P R+AAC C++++
Sbjct:   26 SGQVTNSLAPCINYLRGSGAGAVPPGCCTGIKSLNSA-AQTTPVRQAACRCIKSA 79          

HSP 2 Score: 37.7354 bits (86), Expect = 2.780e-11
Identity = 18/32 (56.25%), Postives = 20/32 (62.50%), Query Frame = 1
Query:  163 KRAYGTIRGIKPNVAAGLPSXCGVRIPYXISP 258
            K A   I GI   +A+GLP  CGV IPY ISP
Sbjct:   77 KSAAAGITGINFGLASGLPGKCGVNIPYKISP 108          
The following BLAST results are available for this feature:
BLAST of CF417087 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
LTP1_MORNI3.248e-1347.27Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP_HELAN6.808e-1351.92Non-specific lipid-transfer protein OS=Helianthus ... [more]
NLTP_MALDO1.203e-1246.00Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP1_PRUDU1.563e-1246.00Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP1_PRUAR5.786e-1246.00Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]
NLTP1_PRUPE9.764e-1246.00Non-specific lipid-transfer protein 1 OS=Prunus pe... [more]
NLTP_PYRCO1.268e-1147.06Non-specific lipid-transfer protein OS=Pyrus commu... [more]
NLTP2_GOSHI2.740e-1145.45Non-specific lipid-transfer protein OS=Gossypium h... [more]
NLTP4_ARATH2.780e-1145.61Non-specific lipid-transfer protein 4 OS=Arabidops... [more]
NLTP1_GOSHI2.780e-1145.45Non-specific lipid-transfer protein OS=Gossypium h... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-017 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-001_B9 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417087 ID=CF417087|Name=CF417087|organism=Citrus sinensis|type=EST|length=485bp
CATAACATGCGGCCCAAGTGACAGCCTCCTTGGNTCCATGCATCCCNTTC
TTGAAAACTGGAGGNCGTTTTTCTCCACCGCCATGCTGTANCGGCGTGCA
GTCTCTCAACGGCGCCGACNAGAACCNACCCCCTGANCGCCGAGCTGCAT
GCAACTGCTTGGAAACGAGCTTACGGAACAATCCGCGGCATCAAACCTAA
TGTTGCCGCTGGCCTTCCTAGTCNATGTGGAGTCAGAATTCCTTACNAGA
TCAGCCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAGTTTGAGC
TCTGTGACTTTCCNAGTATGATTGACTGAGAAGANTNAATAAATAAAGAA
TATCTATGTTAATTTTCTTTGTCCGAACGAGTCTCCCTTGTATGAGTTCA
CTCTCATGNCATGGNTGTATATTGCTTTTTATGTCATATNAATATGTAAC
GCGATCTGTGTTTGAGTGATAAAAAAAAAAAAAAA
back to top