CF417088

Overview
NameCF417088
Unique NameCF417088
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF417088 vs. ExPASy Swiss-Prot
Match: ACBP4_ARATH (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.102e-23
Identity = 62/168 (36.90%), Postives = 95/168 (56.55%), Query Frame = 3
Query:    3 NWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKIFQSPXXXXXXXXXXXXXXXXKSEKLDIPKTLSSKFAGIGN----DLSEKDVRTDIDAIKEDKRVLELSLTEVRTENSRFREK 494
            NW+IVGGGDN +G  E++VLNM+ LAWS++ SV+GR PLASEGLS+  +   GE  LVAFGGYNG+YNNE+ +++   +   + K  ++P                +SE +++ +    +   + N       E +    I  IK +K  LE SL + R +  + R++
Sbjct:  408 NWFIVGGGDNKSGASESVVLNMSTLAWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAFGGYNGRYNNEINLLKPSHKSTLQTKTLEAPLPGSLSAVNNATTRDIESE-VEVSQEGRVREIVMDNVNPGSKVEGNSERIIATIKSEKEELEASLNKERMQTLQLRQE 574          

HSP 2 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 41/94 (43.62%), Postives = 63/94 (67.02%), Query Frame = 1
Query:  400 SELILMLSKRIKECWNCHLRKSGQRILGLEKXIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESLQTIENEVQILRRQKSA 681
            SE I+   K  KE     L K   + L L + + E    +++L KEL SV+GQL AE+SRCFKLE  +AEL++ L++L+T++ E+++L+RQK+A
Sbjct:  543 SERIIATIKSEKEELEASLNKERMQTLQLRQELGEAELRNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKLQTLETLQKELELLQRQKAA 636          
BLAST of CF417088 vs. ExPASy Swiss-Prot
Match: ACBP5_ARATH (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.251e-21
Identity = 49/86 (56.98%), Postives = 63/86 (73.26%), Query Frame = 3
Query:    3 NWYIVGGGDNNNGCQETIVLNMTKLAWSILTSVKGRNPLASEGLSVCSAIIEGEHHLVAFGGYNGKYNNEVFVMRLKPRDIPRPKI 260
            NWYIVGGGDN +G  +T+VLNM+ LAWS++TSV+   PLASEGLS+  +   GE  +VAFGGYNG YNNEV V++   +   + KI
Sbjct:  409 NWYIVGGGDNKSGASKTVVLNMSTLAWSVVTSVQEHVPLASEGLSLVVSSYNGEDIVVAFGGYNGHYNNEVNVLKPSHKSSLKSKI 494          

HSP 2 Score: 74.7146 bits (182), Expect = 5.070e-13
Identity = 36/93 (38.71%), Postives = 66/93 (70.97%), Query Frame = 1
Query:  400 SELILMLSKRIKECWNCHLRKSGQRILGLEKXIDEVNSTHSELSKELSSVQGQLVAERSRCFKLEAQIAELQKMLESLQTIENEVQILRRQKS 678
            ++ I+   K  KE     L K   + L L++ + E+++ ++EL KEL SV+ QL AE+SRCFKLE ++AEL++ L++++T++ E+++L+RQ++
Sbjct:  525 ADRIITTLKSEKEEVEASLNKEKIQTLQLKEELAEIDTRNTELYKELQSVRNQLAAEQSRCFKLEVEVAELRQKLQTMETLQKELELLQRQRA 617          
The following BLAST results are available for this feature:
BLAST of CF417088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ACBP4_ARATH4.102e-2336.90Acyl-CoA-binding domain-containing protein 4 OS=Ar... [more]
ACBP5_ARATH2.251e-2156.98Acyl-CoA-binding domain-containing protein 5 OS=Ar... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-018 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-001_B10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417088 ID=CF417088|Name=CF417088|organism=Citrus sinensis|type=EST|length=684bp
AGAACTGGTACATAGTTGGTGGTGGCGATAATAATAATGGATGCCAAGAA
ACCATTGTGCTAAATATGACTAAGCTGGCATGGTCTATCTTGACAAGTGT
AAAGGGAAGGAATCCACTTGCTAGTGAGGGGCTCAGTGTTTGCTCTGCAA
TAATTGAGGGAGAGCACCATTTGGTAGCCTTTGGTGGCTATAATGGAAAA
TATAATAATGAGGTTTTCGTGATGCGACTCAAACCAAGAGACATACCACG
CCCCAAGATTTTTCAGTCACCAGCAGCGGCGGCGGCTGCAGCTTCTGTTA
CTGCTGCATATGCCTTAGCCAAATCTGAAAAGTTGGATATCCCCAAAACA
TTAAGTTCAAAATTTGCTGGAATTGGAAACGATCTTTCTGAGAAAGATGT
CAGAACTGATATTGATGCTATCAAAGAGGATAAAAGAGTGTTGGAATTGT
CACTTACGGAAGTCAGGACAGAGAATTCTAGGTTTAGAGAAAAGNATTGA
TGAAGTTAACAGTACTCACAGCGAATTATCCAAGGAACTCAGTTCAGTCC
AAGGTCAGCTGGTAGCTGAGAGATCAAGATGCTTTAAACTGGAGGCNCAA
ATAGCAGAGCTACAGAAGATGCTTGAATCATTGCAGACCATAGAAAATGA
AGTGCAAATACTTAGGCGACAGAAGTCTGCCTTT
back to top