CF417201

Overview
NameCF417201
Unique NameCF417201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length511
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF417201 vs. ExPASy Swiss-Prot
Match: Y5880_ARATH (BTB/POZ domain-containing protein At5g48800 OS=Arabidopsis thaliana GN=At5g48800 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.972e-23
Identity = 56/82 (68.29%), Postives = 62/82 (75.61%), Query Frame = 1
Query:    1 RELKLELARLRMRLNDLEKEHVCMKRDMVKSHSRKFMSSFSRKIGKLXXXXXXXXXXXXXXXXXXYRTDSKVI-ERTCASTD 243
            RELKLELARLRMRLNDLEKEH+CMKRDM +SHSRKFMSSFS+K+GKL                  +RTDSKV+ ERTCASTD
Sbjct:  533 RELKLELARLRMRLNDLEKEHICMKRDMQRSHSRKFMSSFSKKMGKLSFFGHSSSRGSSSPSKQSFRTDSKVLMERTCASTD 614          
The following BLAST results are available for this feature:
BLAST of CF417201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y5880_ARATH4.972e-2368.29BTB/POZ domain-containing protein At5g48800 OS=Ara... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-131 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-002_E12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417201 ID=CF417201|Name=CF417201|organism=Citrus sinensis|type=EST|length=511bp
AGAGAGCTAAAACTAGAGTTAGCTCGTTTAAGGATGAGATTAAATGATCT
GGAGAAAGAACATGTATGTATGAAGAGGGATATGGTGAAATCTCATTCTC
GTAAATTTATGAGTTCTTTCTCAAGGAAAATTGGTAAGCTGAGCTTCTTC
GGACACAGTTCCTCACGGGGTTCAAGTTCCCCCTCAAAGAATTCCTACAG
AACCGATTCTAAGGTGATTGAGAGAACATGTGCCAGCACGGATTAGGCAA
TTCACACCAGCAATCTTTTCTCTGTAATTGCCGAGGAGCTGCAAGCCTTG
CTCTGTGACCTCTTTGTTCTAGTTAATTTCCATCTTGGCTTCTCTCTGTA
TATGAGTTGTGATGCTTTGACTTAGCAACGTCCGCACTCCTCTTGAATGC
AAATTGTGTTTTTTTCGCAGTGCGACTTCGACAATGTCTGCATTTTTTAT
TCATCTTAAAAACAATTTCATGTAAACTTGTGCAAAATGCTTATTATAGA
TATTTTGATTA
back to top