CF417202

Overview
NameCF417202
Unique NameCF417202
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length655
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7096 contig Csv1_Contig7096:52..701. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 6.289e-63
Identity = 122/177 (68.93%), Postives = 131/177 (74.01%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGP 574
            F GKAV L+PS +E++  GR++MRKT +K+   SSGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW + G      G    LG P        L H       W      MGAVEGYRIAGGP
Sbjct:   13 FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPS-------LVHAQSILAIWACQVVLMGAVEGYRIAGGP 182          

HSP 2 Score: 23.0978 bits (48), Expect = 6.289e-63
Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLADDPEAF
Sbjct:  200 GLADDPEAF 208          

HSP 3 Score: 75.0998 bits (183), Expect = 3.559e-13
Identity = 40/60 (66.67%), Postives = 44/60 (73.33%), Query Frame = 3
Query:  423 FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWALPGGLGWEPLRVTELLEGRLGEVTDPLY 602
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA    L    +    +  G LGEV DPLY
Sbjct:  133 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL-MGAVEGYRIAGGPLGEVVDPLY 191          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 6.458e-63
Identity = 122/177 (68.93%), Postives = 132/177 (74.58%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGP 574
            F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW + G      G    LG P        L H       W      MGAVEGYR+AGGP
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPS-------LVHAQSILAIWACQVVLMGAVEGYRVAGGP 182          

HSP 2 Score: 75.485 bits (184), Expect = 1.066e-13
Identity = 44/64 (68.75%), Postives = 47/64 (73.44%), Query Frame = 3
Query:  423 FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA----LPGGLGWEPLRVTELLEGRLGEVTDPLY 602
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA    L G +  E  RV     G LGEV DPLY
Sbjct:  133 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAV--EGYRVAG---GPLGEVVDPLY 191          

HSP 3 Score: 21.557 bits (44), Expect = 1.066e-13
Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLA+DPEAF
Sbjct:  200 GLAEDPEAF 208          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 8.434e-63
Identity = 122/177 (68.93%), Postives = 132/177 (74.58%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGP 574
            F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW + G      G    LG P        L H       W      MGAVEGYR+AGGP
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPS-------LVHAQSILAIWACQVVLMGAVEGYRVAGGP 181          

HSP 2 Score: 75.485 bits (184), Expect = 1.066e-13
Identity = 44/64 (68.75%), Postives = 47/64 (73.44%), Query Frame = 3
Query:  423 FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA----LPGGLGWEPLRVTELLEGRLGEVTDPLY 602
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA    L G +  E  RV     G LGEV DPLY
Sbjct:  132 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAV--EGYRVAG---GPLGEVVDPLY 190          

HSP 3 Score: 21.557 bits (44), Expect = 1.066e-13
Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLA+DPEAF
Sbjct:  199 GLAEDPEAF 207          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 2.454e-62
Identity = 120/175 (68.57%), Postives = 129/175 (73.71%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGP 574
            F G+AV L+PS  E++  GR+SMRKT +K V+S SPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW + G      G    LG P        L H       W      MGAVEGYR+AGGP
Sbjct:   13 FAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPS-------LVHAQSILAIWACQVILMGAVEGYRVAGGP 180          

HSP 2 Score: 75.485 bits (184), Expect = 1.066e-13
Identity = 44/64 (68.75%), Postives = 47/64 (73.44%), Query Frame = 3
Query:  423 FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA----LPGGLGWEPLRVTELLEGRLGEVTDPLY 602
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA    L G +  E  RV     G LGEV DPLY
Sbjct:  131 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV--EGYRVAG---GPLGEVVDPLY 189          

HSP 3 Score: 21.557 bits (44), Expect = 1.066e-13
Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLA+DPEAF
Sbjct:  198 GLAEDPEAF 206          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.205e-62
Identity = 121/175 (69.14%), Postives = 128/175 (73.14%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGP 574
            F G+AV L+PS +E+S  GRI+MRK  +KS  S SPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW + G      G    LG P        L H       W      MGAVEGYRIAGGP
Sbjct:   13 FAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPS-------LVHAQSILAIWACQVVLMGAVEGYRIAGGP 180          

HSP 2 Score: 75.0998 bits (183), Expect = 1.385e-13
Identity = 40/60 (66.67%), Postives = 44/60 (73.33%), Query Frame = 3
Query:  423 FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWALPGGLGWEPLRVTELLEGRLGEVTDPLY 602
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA    L    +    +  G LGEV DPLY
Sbjct:  131 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL-MGAVEGYRIAGGPLGEVVDPLY 189          

HSP 3 Score: 21.557 bits (44), Expect = 1.385e-13
Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLA+DPEAF
Sbjct:  198 GLAEDPEAF 206          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 5.258e-62
Identity = 122/183 (66.67%), Postives = 130/183 (71.04%), Query Frame = 2
Query:   74 GKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGPAR*SD*PIVP 604
            G+AV L+P+  E+    + +MRKT SKSVSSGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW + G      G    LG P        L H       W      MGAVEGYRIAGGP      PI P
Sbjct:    5 GQAVKLSPNAPEIQGNAKFTMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPS-------LVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYP 180          

HSP 2 Score: 23.0978 bits (48), Expect = 5.258e-62
Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLADDPEAF
Sbjct:  188 GLADDPEAF 196          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 7.140e-62
Identity = 120/177 (67.80%), Postives = 132/177 (74.58%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGP 574
            F GKAV L+PS +E++  G+++MRKT +K+  +SSGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW + G      G    LG P        L H       W      MGAVEGYR+AGGP
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPS-------LVHAQSILAIWACQVVLMGAVEGYRVAGGP 182          

HSP 2 Score: 75.485 bits (184), Expect = 1.066e-13
Identity = 44/64 (68.75%), Postives = 47/64 (73.44%), Query Frame = 3
Query:  423 FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA----LPGGLGWEPLRVTELLEGRLGEVTDPLY 602
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA    L G +  E  RV     G LGEV DPLY
Sbjct:  133 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAV--EGYRVAG---GPLGEVVDPLY 191          

HSP 3 Score: 21.557 bits (44), Expect = 1.066e-13
Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLA+DPEAF
Sbjct:  200 GLAEDPEAF 208          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.591e-61
Identity = 120/177 (67.80%), Postives = 131/177 (74.01%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGP 574
            F GKAV L+PS +E++  G+++MRKT +K+  VSSGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW + G      G    LG P        L H       W      MGAVEGYR+AG P
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPS-------LVHAQSILAIWACQVVLMGAVEGYRVAGEP 181          

HSP 2 Score: 72.4034 bits (176), Expect = 8.643e-13
Identity = 43/64 (67.19%), Postives = 46/64 (71.88%), Query Frame = 3
Query:  423 FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA----LPGGLGWEPLRVTELLEGRLGEVTDPLY 602
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA    L G +  E  RV       LGEV DPLY
Sbjct:  132 FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAV--EGYRVAG---EPLGEVVDPLY 190          

HSP 3 Score: 21.557 bits (44), Expect = 8.643e-13
Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLA+DPEAF
Sbjct:  199 GLAEDPEAF 207          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.591e-61
Identity = 120/177 (67.80%), Postives = 132/177 (74.58%), Query Frame = 2
Query:   68 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSW------MGAVEGYRIAGGP 574
            F GKAV L+PS +E++  G+++MRKT SK+  VSS SPWYG +RVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW +GG     +G    LG P        L H       W      MGAVEGYR+AG P
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKGGSQIFSQGGLDYLGNPS-------LVHAQSILAIWACQVVLMGAVEGYRVAGEP 182          

HSP 2 Score: 69.707 bits (169), Expect = 5.384e-12
Identity = 41/64 (64.06%), Postives = 45/64 (70.31%), Query Frame = 3
Query:  423 FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA----LPGGLGWEPLRVTELLEGRLGEVTDPLY 602
            FK G+QIFS+GGLDYLGNPSL+HAQSILAIWA    L G +  E  RV       LGEV DPLY
Sbjct:  133 FKGGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAV--EGYRVAG---EPLGEVVDPLY 191          

HSP 3 Score: 21.557 bits (44), Expect = 5.384e-12
Identity = 8/9 (88.89%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLA+DPEAF
Sbjct:  200 GLAEDPEAF 208          
BLAST of CF417202 vs. ExPASy Swiss-Prot
Match: CB23_SOYBN (Chlorophyll a-b binding protein 3, chloroplastic OS=Glycine max GN=CAB3 PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.981e-61
Identity = 123/177 (69.49%), Postives = 130/177 (73.45%), Query Frame = 2
Query:   74 GKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGLDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWVQGGGPDLQRGRA*LLGEPKPDPRPEHLGHLGFARWSWMGAVEGYRIAGGPAR*SD*PIVP 604
            GKAV L PS  E+   GR+SMRKT +K VSSGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW + G      G    LG P        L  +   +   MGAVEGYRIAGGP      PI P
Sbjct:   16 GKAVKLGPSAPEV---GRVSMRKTVTKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILA-IWATQVILMGAVEGYRIAGGPLGEVTDPIYP 188          

HSP 2 Score: 23.0978 bits (48), Expect = 1.981e-61
Identity = 9/9 (100.00%), Postives = 9/9 (100.00%), Query Frame = 1
Query:  628 GLADDPEAF 654
            GLADDPEAF
Sbjct:  196 GLADDPEAF 204          
The following BLAST results are available for this feature:
BLAST of CF417202 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
CB2G_SOLLC6.289e-6368.93Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC6.458e-6368.93Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC8.434e-6368.93Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB22_TOBAC2.454e-6268.57Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB2B_SOLLC3.205e-6269.14Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB21_CUCSA5.258e-6266.67Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB25_TOBAC7.140e-6267.80Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB25_NICPL1.591e-6167.80Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB23_NICPL1.591e-6167.80Chlorophyll a-b binding protein C, chloroplastic O... [more]
CB23_SOYBN1.981e-6169.49Chlorophyll a-b binding protein 3, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-132 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-002_F1 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417202 ID=CF417202|Name=CF417202|organism=Citrus sinensis|type=EST|length=655bp
TTACCCAGCTTCTGCTTCTCAATTAAATTCCTCAATGGCAACCTCAACAA
TGGCTCTCTCCTCATCATTCGTCGGCAAGGCCGTGAACCTCGCCCCTTCA
GGCAATGAGCTAAGCAATGGTGGCCGCATCTCCATGCGTAAAACCGGGAG
CAAGTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCTAGACAGAGTCAAGT
ACTTGGGCCCATTCTCTGGCGAGCCCCCAAGCTACTTGACCGGTGAGTTC
CCTGGCGACTACGGTTGGGACACAGCCGGGCTTTCAGCTGACCCAGAAAC
CTTTGCCAAGAACCGTGAACTCGAAGTCATCCACTGCAGATGGGCCATGT
TGGGAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCAACGGAGTC
AAGTTCGGTGAGGCCGTATGGGTTCAAGGCGGGGGCCCAGATCTTCAGCG
AGGGCGGGCTTGACTACTTGGGGAACCCAAGCCTGATCCACGCCCAGAGC
ATCTTGGCCATCTGGGCTTTGCCAGGTGGTCTTGGATGGGAGCCGTTGAG
GGTTACAGAATTGCTGGAGGGCCGGCTCGGTGAAGTGACTGACCCATTGT
ACCCAGGTGGCAGCTTTGATCCATTGGGGTTTGGCTGATGACCCGGAGGC
TTTTG
back to top