CF417210

Overview
NameCF417210
Unique NameCF417210
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length643
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS13_SOYBN (40S ribosomal protein S13 OS=Glycine max GN=RPS13 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 6.005e-66
Identity = 125/128 (97.66%), Postives = 127/128 (99.22%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            SWLKISSQDVE+NICKFAKKGLTPSQIGVILRDSHGIAQV SVTGSKILRILKAHGLAPEIPEDLYHLIKKAV+IRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA
Sbjct:   24 SWLKISSQDVEENICKFAKKGLTPSQIGVILRDSHGIAQVNSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS13_PEA (40S ribosomal protein S13 OS=Pisum sativum GN=RPS13 PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.932e-64
Identity = 123/128 (96.09%), Postives = 126/128 (98.44%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            SWLKISSQDV++ ICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAV+IRKHLER RKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA
Sbjct:   24 SWLKISSQDVDETICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVSIRKHLERFRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS132_ARATH (40S ribosomal protein S13-2 OS=Arabidopsis thaliana GN=RPS13B PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.932e-64
Identity = 122/128 (95.31%), Postives = 126/128 (98.44%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            SWLK +SQDV+++ICKFAKKGLTPSQIGVILRDSHGI QVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA
Sbjct:   24 SWLKTTSQDVDESICKFAKKGLTPSQIGVILRDSHGIPQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS131_ARATH (40S ribosomal protein S13-1 OS=Arabidopsis thaliana GN=RPS13A PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 7.341e-64
Identity = 121/128 (94.53%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            SWLK + QDV+++ICKFAKKGLTPSQIGVILRDSHGI QVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA
Sbjct:   24 SWLKTTPQDVDESICKFAKKGLTPSQIGVILRDSHGIPQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS132_ORYSJ (40S ribosomal protein S13-2 OS=Oryza sativa subsp. japonica GN=Os08g0117300 PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 8.691e-57
Identity = 111/128 (86.72%), Postives = 116/128 (90.62%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            SWLK ++ DVE+ I K AKKG  PSQIGV+LRD HGI  VKSVTGSKILRILKAHGLAPEIPEDLY LIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYK+TKKLPP WKYESTTASTLVA
Sbjct:   24 SWLKTAASDVEEMIMKAAKKGQMPSQIGVVLRDQHGIPLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKRTKKLPPTWKYESTTASTLVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS13_MAIZE (40S ribosomal protein S13 OS=Zea mays GN=RPS13 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.529e-56
Identity = 110/128 (85.94%), Postives = 116/128 (90.62%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            +WLK ++ DVE+ I K AKKG  PSQIGV+LRD HGI  VKSVTGSKILRILKAHGLAPEIPEDLY LIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYK+TKKLPP WKYESTTASTLVA
Sbjct:   24 TWLKTAASDVEEMITKAAKKGQMPSQIGVLLRDQHGIPLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKRTKKLPPTWKYESTTASTLVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS131_ORYSJ (40S ribosomal protein S13-1 OS=Oryza sativa subsp. japonica GN=Os08g0117200 PE=2 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 2.529e-56
Identity = 110/128 (85.94%), Postives = 116/128 (90.62%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            SW+K ++ DVE+ I K AKKG  PSQIGV+LRD HGI  VKSVTGSKILRILKAHGLAPEIPEDLY LIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYK+TKKLPP WKYESTTASTLVA
Sbjct:   24 SWVKTAAADVEEMIMKAAKKGQMPSQIGVVLRDQHGIPLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKRTKKLPPTWKYESTTASTLVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS13_XENLA (40S ribosomal protein S13 OS=Xenopus laevis GN=rps13 PE=3 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 8.994e-54
Identity = 101/128 (78.91%), Postives = 117/128 (91.41%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            +WLK++S DV++ I K AKKGLTPSQIGVILRDSHG+AQV+ VTG+KILRILK+ GLAP++PEDLYHLIKKAVA+RKHLERNRKDKD+KFRLIL+ESRIHRLARYYK  + LPP WKYES+TAS LVA
Sbjct:   24 TWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTRRVLPPNWKYESSTASALVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS13_RAT (40S ribosomal protein S13 OS=Rattus norvegicus GN=Rps13 PE=2 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 8.994e-54
Identity = 101/128 (78.91%), Postives = 117/128 (91.41%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            +WLK++S DV++ I K AKKGLTPSQIGVILRDSHG+AQV+ VTG+KILRILK+ GLAP++PEDLYHLIKKAVA+RKHLERNRKDKD+KFRLIL+ESRIHRLARYYK  + LPP WKYES+TAS LVA
Sbjct:   24 TWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA 151          
BLAST of CF417210 vs. ExPASy Swiss-Prot
Match: RS13_MOUSE (40S ribosomal protein S13 OS=Mus musculus GN=Rps13 PE=1 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 8.994e-54
Identity = 101/128 (78.91%), Postives = 117/128 (91.41%), Query Frame = 2
Query:    2 SWLKISSQDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA 385
            +WLK++S DV++ I K AKKGLTPSQIGVILRDSHG+AQV+ VTG+KILRILK+ GLAP++PEDLYHLIKKAVA+RKHLERNRKDKD+KFRLIL+ESRIHRLARYYK  + LPP WKYES+TAS LVA
Sbjct:   24 TWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA 151          
The following BLAST results are available for this feature:
BLAST of CF417210 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
RS13_SOYBN6.005e-6697.6640S ribosomal protein S13 OS=Glycine max GN=RPS13 ... [more]
RS13_PEA1.932e-6496.0940S ribosomal protein S13 OS=Pisum sativum GN=RPS1... [more]
RS132_ARATH1.932e-6495.3140S ribosomal protein S13-2 OS=Arabidopsis thalian... [more]
RS131_ARATH7.341e-6494.5340S ribosomal protein S13-1 OS=Arabidopsis thalian... [more]
RS132_ORYSJ8.691e-5786.7240S ribosomal protein S13-2 OS=Oryza sativa subsp.... [more]
RS13_MAIZE2.529e-5685.9440S ribosomal protein S13 OS=Zea mays GN=RPS13 PE=... [more]
RS131_ORYSJ2.529e-5685.9440S ribosomal protein S13-1 OS=Oryza sativa subsp.... [more]
RS13_XENLA8.994e-5478.9140S ribosomal protein S13 OS=Xenopus laevis GN=rps... [more]
RS13_RAT8.994e-5478.9140S ribosomal protein S13 OS=Rattus norvegicus GN=... [more]
RS13_MOUSE8.994e-5478.9140S ribosomal protein S13 OS=Mus musculus GN=Rps13... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-140 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-002_F9 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417210 ID=CF417210|Name=CF417210|organism=Citrus sinensis|type=EST|length=643bp
AAGTTGGCTCAAGATTTCCAGCCAAGATGTTGAGGATAACATCTGTAAGT
TTGCAAAGAAGGGTTTGACTCCATCACAGATTGGTGTTATTCTTCGTGAC
TCTCACGGTATTGCCCAGGTTAAGAGCGTTACTGGAAGCAAGATTTTGCG
TATCCTCAAGGCTCATGGACTCGCACCTGAAATTCCTGAGGATCTGTACC
ACCTCATCAAGAAGGCTGTTGCTATTAGGAAGCATTTGGAAAGGAACAGG
AAGGACAAGGATTCCAAGTTCCGCTTGATTCTTGTTGAAAGCAGGATTCA
CAGGCTTGCTCGCTACTACAAGAAAACCAAGAAGCTTCCTCCTGTCTGGA
AATATGAGTCTACTACCGCCAGCACACTTGTGGCTTAGGCTAAGCAAGAT
GCTAGGCGTTGTTTGTGATATCCTTTGTTGGTATCACAACACTCTTTAAG
GAGCCTGATGATTTTATGGTGGATTAGTATAAGTTCAGATGTAAGACCTT
TATTCATAGTTTTTTTGGAAAGATTTAGTCCTTGGAGGAACAGAAATTTG
GAACTTGTTTTTTATTTTGTTGCCTAACGTTTTGTTTCCTTTNCGAAATT
TTGTATTTTTGATGCACTTTATATTCGCTAAAAAAAAAAAAAA
back to top