CF417232
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: SFRS2_RAT (Splicing factor, arginine/serine-rich 2 OS=Rattus norvegicus GN=Sfrs2 PE=1 SV=3) HSP 1 Score: 82.0333 bits (201), Expect = 3.176e-15 Identity = 39/77 (50.65%), Postives = 57/77 (74.03%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG--PNAERIQKG 228 D L +F+KYG+V D++IPRDR T +SRGFAFVR+ +A+ A+D +DG V+DGRE+ VQ A+YG P++ ++G Sbjct: 28 DTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRG 104
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: SFRS2_PIG (Splicing factor, arginine/serine-rich 2 OS=Sus scrofa GN=SFRS2 PE=2 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 3.176e-15 Identity = 39/77 (50.65%), Postives = 57/77 (74.03%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG--PNAERIQKG 228 D L +F+KYG+V D++IPRDR T +SRGFAFVR+ +A+ A+D +DG V+DGRE+ VQ A+YG P++ ++G Sbjct: 28 DTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRG 104
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: SFRS2_PANTR (Splicing factor, arginine/serine-rich 2 OS=Pan troglodytes GN=SFRS2 PE=2 SV=3) HSP 1 Score: 82.0333 bits (201), Expect = 3.176e-15 Identity = 39/77 (50.65%), Postives = 57/77 (74.03%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG--PNAERIQKG 228 D L +F+KYG+V D++IPRDR T +SRGFAFVR+ +A+ A+D +DG V+DGRE+ VQ A+YG P++ ++G Sbjct: 28 DTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRG 104
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: SFRS2_MOUSE (Splicing factor, arginine/serine-rich 2 OS=Mus musculus GN=Sfrs2 PE=1 SV=4) HSP 1 Score: 82.0333 bits (201), Expect = 3.176e-15 Identity = 39/77 (50.65%), Postives = 57/77 (74.03%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG--PNAERIQKG 228 D L +F+KYG+V D++IPRDR T +SRGFAFVR+ +A+ A+D +DG V+DGRE+ VQ A+YG P++ ++G Sbjct: 28 DTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRG 104
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: SFRS2_HUMAN (Splicing factor, arginine/serine-rich 2 OS=Homo sapiens GN=SFRS2 PE=1 SV=4) HSP 1 Score: 82.0333 bits (201), Expect = 3.176e-15 Identity = 39/77 (50.65%), Postives = 57/77 (74.03%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG--PNAERIQKG 228 D L +F+KYG+V D++IPRDR T +SRGFAFVR+ +A+ A+D +DG V+DGRE+ VQ A+YG P++ ++G Sbjct: 28 DTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRG 104
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: SFRS2_CHICK (Splicing factor, arginine/serine-rich 2 OS=Gallus gallus GN=SFRS2 PE=2 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 3.176e-15 Identity = 39/77 (50.65%), Postives = 57/77 (74.03%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG--PNAERIQKG 228 D L +F+KYG+V D++IPRDR T +SRGFAFVR+ +A+ A+D +DG V+DGRE+ VQ A+YG P++ ++G Sbjct: 28 DTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRG 104
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: SFRS2_BOVIN (Splicing factor, arginine/serine-rich 2 OS=Bos taurus GN=SFRS2 PE=2 SV=3) HSP 1 Score: 82.0333 bits (201), Expect = 3.176e-15 Identity = 39/77 (50.65%), Postives = 57/77 (74.03%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG--PNAERIQKG 228 D L +F+KYG+V D++IPRDR T +SRGFAFVR+ +A+ A+D +DG V+DGRE+ VQ A+YG P++ ++G Sbjct: 28 DTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRG 104
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: RSP4_CAEEL (Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 5.606e-12 Identity = 35/76 (46.05%), Postives = 52/76 (68.42%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG-PNAERIQKG 228 +DL F++YG + D+ IPRD+ + S+GF FVR+ +A+ A+DR DG++VDGRE+ V AKY P+ ER +G Sbjct: 33 NDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKLVDGRELRVTLAKYDRPSDERGGRG 108
BLAST of CF417232 vs. ExPASy Swiss-Prot
Match: SFR2B_HUMAN (Splicing factor, arginine/serine-rich 2B OS=Homo sapiens GN=SFRS2B PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.633e-11 Identity = 33/66 (50.00%), Postives = 45/66 (68.18%), Query Frame = 1 Query: 4 DDLFPLFDKYGKVVDIFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG 201 D L +F+KYG+V D++IPR+ T RGFAFVR+ +AQ A +DG +DGRE+ VQ A+YG Sbjct: 28 DSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYG 93 The following BLAST results are available for this feature:
BLAST of CF417232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 9
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF417232 ID=CF417232; Name=CF417232; organism=Citrus sinensis; type=EST; length=685bpback to top |