CF503807

Overview
NameCF503807
Unique NameCF503807
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length282
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5604 contig Csv1_Contig5604:7..287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_CITUN (Defender against cell death 1 OS=Citrus unshiu GN=DAD1 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.896e-35
Identity = 74/78 (94.87%), Postives = 76/78 (97.44%), Query Frame = 1
Query:   49 KTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            K  QALFHSLRSAYAATPTTLKIIDLYVGFAVFT++IQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN
Sbjct:    7 KDAQALFHSLRSAYAATPTTLKIIDLYVGFAVFTALIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 84          

HSP 2 Score: 23.0978 bits (48), Expect = 2.896e-35
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 3
Query:   30 MARSTGKDASSPF 68
            MARSTGKDA + F
Sbjct:    1 MARSTGKDAQALF 13          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_SOLLC (Defender against cell death 1 OS=Solanum lycopersicum GN=DAD1 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.609e-32
Identity = 68/78 (87.18%), Postives = 73/78 (93.59%), Query Frame = 1
Query:   49 KTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            K  QALFHSLRSAYAATPT LKIIDLYV FA+ T++IQVVYMAIVGSFPFNSFLSGVLSC+GTAVLAVCLRIQVNK+N
Sbjct:    8 KDAQALFHSLRSAYAATPTNLKIIDLYVIFAISTALIQVVYMAIVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKEN 85          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_MALDO (Defender against cell death 1 OS=Malus domestica GN=DAD1 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.214e-31
Identity = 67/79 (84.81%), Postives = 74/79 (93.67%), Query Frame = 1
Query:   46 AKTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            A+   ALF SLRSAY+ATPTTLKIIDLY+GFAV T++IQVVYMAIVGSFPFNSFLSGVLSC+GTAVLAVCLRIQVNK+N
Sbjct:   10 AQDAVALFDSLRSAYSATPTTLKIIDLYIGFAVSTALIQVVYMAIVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKEN 88          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_ARATH (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Arabidopsis thaliana GN=DAD1 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 6.441e-31
Identity = 66/79 (83.54%), Postives = 73/79 (92.41%), Query Frame = 1
Query:   46 AKTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            +K  Q LF SLRSAY+ATPT LKIIDLYV FAVFT++IQVVYMA+VGSFPFNSFLSGVLSC+GTAVLAVCLRIQVNK+N
Sbjct:    6 SKDAQDLFRSLRSAYSATPTNLKIIDLYVVFAVFTALIQVVYMALVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKEN 84          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD2_ARATH (Defender against cell death 2 OS=Arabidopsis thaliana GN=DAD2 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.099e-30
Identity = 65/79 (82.28%), Postives = 71/79 (89.87%), Query Frame = 1
Query:   46 AKTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            +K  Q LFHSL SAY ATPT LKIIDLYV FAVFT++IQV YMA+VGSFPFNSFLSGVLSC+GTAVLAVCLRIQVNK+N
Sbjct:    6 SKDAQDLFHSLHSAYTATPTNLKIIDLYVCFAVFTALIQVAYMALVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKEN 84          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_BETVE (Defender against cell death 1 OS=Betula verrucosa GN=DAD1 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.448e-30
Identity = 65/79 (82.28%), Postives = 73/79 (92.41%), Query Frame = 1
Query:   46 AKTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            +K  QAL  SLRSAYAATP+ LKIIDLYV FAVFT++IQVVYMAIVGSFPFN+FLSG+LSC+GTAVLAVCLRIQVNK+N
Sbjct:    6 SKDAQALIQSLRSAYAATPSNLKIIDLYVVFAVFTALIQVVYMAIVGSFPFNAFLSGLLSCIGTAVLAVCLRIQVNKEN 84          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_PEA (Defender against cell death 1 OS=Pisum sativum GN=DAD1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.028e-28
Identity = 62/78 (79.49%), Postives = 70/78 (89.74%), Query Frame = 1
Query:   49 KTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            K  Q LFH++ SAY+ATPT LKIIDLYV FAVFT+++Q VYMA+VG FPFNSFLSGVLSCVGTAVLAVCLRIQVNK+N
Sbjct:    9 KDAQDLFHAIWSAYSATPTNLKIIDLYVVFAVFTALLQDVYMALVGPFPFNSFLSGVLSCVGTAVLAVCLRIQVNKEN 86          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_PICMA (Defender against cell death 1 OS=Picea mariana GN=DAD1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.343e-28
Identity = 62/79 (78.48%), Postives = 70/79 (88.61%), Query Frame = 1
Query:   46 AKTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            AK   AL  SLRSAY+ATPT LKIIDLYV +A+ T+V+QVVYMAIVGSFPFN+FLSGVLSC GTAVLAVCLR+QVNK+N
Sbjct:    6 AKEAHALIASLRSAYSATPTKLKIIDLYVVYAILTAVVQVVYMAIVGSFPFNAFLSGVLSCTGTAVLAVCLRMQVNKEN 84          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_ORYSJ (Defender against cell death 1 OS=Oryza sativa subsp. japonica GN=DAD1 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 5.104e-28
Identity = 63/81 (77.78%), Postives = 67/81 (82.72%), Query Frame = 1
Query:   40 RPAKTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            R     + L  SL  AYAATPT LKIIDLYV FAV T++IQVVYM IVGSFPFNSFLSGVLSC+GTAVLAVCLRIQVNKDN
Sbjct:    3 RATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKDN 83          
BLAST of CF503807 vs. ExPASy Swiss-Prot
Match: DAD1_ORYSI (Defender against cell death 1 OS=Oryza sativa subsp. indica GN=DAD1 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 5.104e-28
Identity = 63/81 (77.78%), Postives = 67/81 (82.72%), Query Frame = 1
Query:   40 RPAKTPQALFHSLRSAYAATPTTLKIIDLYVGFAVFTSVIQVVYMAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDN 282
            R     + L  SL  AYAATPT LKIIDLYV FAV T++IQVVYM IVGSFPFNSFLSGVLSC+GTAVLAVCLRIQVNKDN
Sbjct:    3 RATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKDN 83          
The following BLAST results are available for this feature:
BLAST of CF503807 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
DAD1_CITUN2.896e-3594.87Defender against cell death 1 OS=Citrus unshiu GN=... [more]
DAD1_SOLLC7.609e-3287.18Defender against cell death 1 OS=Solanum lycopersi... [more]
DAD1_MALDO2.214e-3184.81Defender against cell death 1 OS=Malus domestica G... [more]
DAD1_ARATH6.441e-3183.54Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
DAD2_ARATH1.099e-3082.28Defender against cell death 2 OS=Arabidopsis thali... [more]
DAD1_BETVE2.448e-3082.28Defender against cell death 1 OS=Betula verrucosa ... [more]
DAD1_PEA1.028e-2879.49Defender against cell death 1 OS=Pisum sativum GN=... [more]
DAD1_PICMA1.343e-2878.48Defender against cell death 1 OS=Picea mariana GN=... [more]
DAD1_ORYSJ5.104e-2877.78Defender against cell death 1 OS=Oryza sativa subs... [more]
DAD1_ORYSI5.104e-2877.78Defender against cell death 1 OS=Oryza sativa subs... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-293 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_A06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503807 ID=CF503807|Name=CF503807|organism=Citrus sinensis|type=EST|length=282bp
CAGAGAGAAAGACAGATTACAGAGAGGAAATGGCGAGATCGACCGGCAAA
GACGCCTCAAGCCCTTTTCCATTCCCTTCGCTCTGCTTATGCTGCCACTC
CCACGACTCTTAAGATCATCGATCTGTATGTGGGTTTCGCGGTTTTTACT
TCCGTAATTCAGGTAGTTTACATGGCTATTGTTGGATCCTTCCCATTCAA
CTCTTTTCTTTCAGGAGTACTTTCTTGTGTTGGGACGGCAGTCCTTGCTG
TTTGTCTACGTATTCAAGTGAACAAGGACAAC
back to top