CF503810

Overview
NameCF503810
Unique NameCF503810
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length487
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13130 contig Csv1_Contig13130:97..583. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503810 vs. ExPASy Swiss-Prot
Match: ALEU_ARATH (Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 7.251e-42
Identity = 85/134 (63.43%), Postives = 108/134 (80.60%), Query Frame = 1
Query:   76 LVSSVILLLCCXXXXXXXXXXFDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRHRLGAAQNCSATTKGNHKLT 477
            ++SSV+L++            FD+SNPIR+VS DGLR+ E SV Q++GQ+RH LSFARF  RYGK Y++VEEMKLRF+ F +NLDLIRSTN KGLSY+LG+N+FAD +W+EFQR +LGAAQNCSAT KG+HK+T
Sbjct:    6 ILSSVVLVVLVAASAAANIG-FDESNPIRMVS-DGLREVEESVSQILGQSRHVLSFARFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFADLTWQEFQRTKLGAAQNCSATLKGSHKVT 137          
BLAST of CF503810 vs. ExPASy Swiss-Prot
Match: ALEUL_ARATH (Thiol protease aleurain-like OS=Arabidopsis thaliana GN=At3g45310 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 3.598e-41
Identity = 83/140 (59.29%), Postives = 109/140 (77.86%), Query Frame = 1
Query:   58 MARPVQLVSSVILLLCCXXXXXXXXXXFDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRHRLGAAQNCSATTKGNHKLT 477
            M+  + L SS++L+L            FD+SNPI++VS D L + E +V+Q++GQ+RH LSF+RF  RYGK Y+SVEEMKLRF+ F +NLDLIRSTN KGLSY+L LN+FAD +W+EFQR++LGAAQNCSAT KG+HK+T
Sbjct:    1 MSVKLNLSSSILLILFAAAASKEIG--FDESNPIKMVS-DNLHELEDTVVQILGQSRHVLSFSRFTHRYGKKYQSVEEMKLRFSVFKENLDLIRSTNKKGLSYKLSLNQFADLTWQEFQRYKLGAAQNCSATLKGSHKIT 137          
BLAST of CF503810 vs. ExPASy Swiss-Prot
Match: CYSP2_MAIZE (Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.371e-32
Identity = 69/114 (60.53%), Postives = 83/114 (72.81%), Query Frame = 1
Query:  139 FDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRHRLGAAQNCSATTKGNHKLTA 480
            F DSNPIR V+       E++V   +G+ R AL FARFA RYGK YES  E+  RF  FS++L L+RSTN KGLSYRLG+N+FAD SWEEF+  RLGAAQNCSAT  GNH++ A
Sbjct:   25 FADSNPIRPVTDRAASALESTVFAALGRTRDALRFARFAVRYGKSYESAAEVHKRFRIFSESLQLVRSTNRKGLSYRLGINRFADMSWEEFRATRLGAAQNCSATLTGNHRMRA 138          
BLAST of CF503810 vs. ExPASy Swiss-Prot
Match: ALEU_HORVU (Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 6.802e-32
Identity = 67/110 (60.91%), Postives = 81/110 (73.64%), Query Frame = 1
Query:  139 FDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRHRLGAAQNCSATTKGNH 468
            F DSNPIR V+       E++VL  +G+ RHAL FARFA RYGK YES  E++ RF  FS++L+ +RSTN KGL YRLG+N+F+D SWEEFQ  RLGAAQ CSAT  GNH
Sbjct:   27 FADSNPIRPVTDRAASTLESAVLGALGRTRHALRFARFAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKGLPYRLGINRFSDMSWEEFQATRLGAAQTCSATLAGNH 136          
BLAST of CF503810 vs. ExPASy Swiss-Prot
Match: ORYC_ORYSJ (Oryzain gamma chain OS=Oryza sativa subsp. japonica GN=Os09g0442300 PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 8.884e-32
Identity = 65/112 (58.04%), Postives = 83/112 (74.11%), Query Frame = 1
Query:  139 FDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRHRLGAAQNCSATTKGNHKL 474
            FDDSNPIR V+       E++V+  +G+ R AL FARFA R+GK Y    E++ RF  FS++L+L+RSTN +GL YRLG+N+FAD SWEEFQ  RLGAAQNCSAT  GNH++
Sbjct:   28 FDDSNPIRSVTDHAASALESTVIAALGRTRDALRFARFAVRHGKRYGDAAEVQRRFRIFSESLELVRSTNRRGLPYRLGINRFADMSWEEFQASRLGAAQNCSATLAGNHRM 139          
BLAST of CF503810 vs. ExPASy Swiss-Prot
Match: CYSP3_SOLLC (Cysteine proteinase 3 OS=Solanum lycopersicum GN=CYP-3 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 8.884e-32
Identity = 69/113 (61.06%), Postives = 85/113 (75.22%), Query Frame = 1
Query:  139 FDDSNPIRLVSSDGLRDFETSVLQVIGQARHALSFARFARRYGKIYESVEEMKLRFATFSKNLDLIRSTNCKGLSYRLGLNKFADWSWEEFQRHRLGAAQNCSATTKGNHKLT 477
            F D NPIR V      + E  +LQV+GQ R ALSFARFA R+ K Y+SVEE+K RF  F  NL +IRS N KGLSY+LG+N+F D +W+EF++H+LGA+QNCSATTKGN KLT
Sbjct:   25 FADKNPIRQVVFPD--ELENGILQVVGQTRSALSFARFAIRHRKRYDSVEEIKQRFEIFLDNLKMIRSHNRKGLSYKLGINEFTDLTWDEFRKHKLGASQNCSATTKGNLKLT 135          
The following BLAST results are available for this feature:
BLAST of CF503810 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ALEU_ARATH7.251e-4263.43Thiol protease aleurain OS=Arabidopsis thaliana GN... [more]
ALEUL_ARATH3.598e-4159.29Thiol protease aleurain-like OS=Arabidopsis thalia... [more]
CYSP2_MAIZE1.371e-3260.53Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=... [more]
ALEU_HORVU6.802e-3260.91Thiol protease aleurain OS=Hordeum vulgare PE=2 SV... [more]
ORYC_ORYSJ8.884e-3258.04Oryzain gamma chain OS=Oryza sativa subsp. japonic... [more]
CYSP3_SOLLC8.884e-3261.06Cysteine proteinase 3 OS=Solanum lycopersicum GN=C... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-296 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_A09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503810 ID=CF503810|Name=CF503810|organism=Citrus sinensis|type=EST|length=487bp
CCGAAGCCCTTGAGTGCAGTGTGCTCTCTCCAAACAAAGCAGACACAATC
ATTAGGCATGGCTCGCCCCGTACAGTTGGTCTCGTCCGTCATCTTGTTGC
TTTGCTGCGCTGCCGCAGCATCAGCATCAGCATCAAGCTTCGACGACTCC
AATCCGATCAGATTGGTATCATCGGACGGTCTCCGTGACTTCGAGACCTC
CGTCCTCCAGGTGATCGGCCAAGCCCGCCATGCTCTCTCCTTTGCCCGTT
TTGCTCGCAGGTATGGGAAGATTTACGAGTCCGTTGAGGAGATGAAGCTC
CGGTTCGCGACTTTCTCCAAGAACTTGGATTTAATCAGATCTACCAATTG
TAAAGGCCTATCTTACAGGCTCGGGTTGAACAAGTTTGCTGACTGGAGCT
GGGAAGAGTTCCAAAGGCACAGGTTGGGAGCTGCGCAAAACTGCTCTGCC
ACTACAAAAGGAAATCACAAGCTTACTGCTGATGTGC
back to top