CF503812

Overview
NameCF503812
Unique NameCF503812
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length511
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7698 contig Csv1_Contig7698:69..579. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_DATST (Ornithine decarboxylase OS=Datura stramonium PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.440e-38
Identity = 81/153 (52.94%), Postives = 103/153 (67.32%), Query Frame = 1
Query:   52 RVTTVVTKDELTEFMQSTILKRQEFDEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            R    +++D L +FM S I ++ + ++ PFY++DLG VVSL +   + LP I P YAVKCN            GSNFDC SR+EIE VL LG+SPDRI++ANPCKP S I +AA VGVNLTT DS +E+ KIR  HPK +LL+RIK  DD  A
Sbjct:   36 RKVVPLSRDALQDFMVSIITQKLQDEKQPFYVLDLGEVVSLMDQWNAGLPNIRPFYAVKCNPEPSFLSMLSAMGSNFDCASRAEIEYVLSLGISPDRIVFANPCKPESDIIFAAKVGVNLTTFDSEDEVYKIRKHHPKCELLLRIKPMDDGNA 188          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_SOLLC (Ornithine decarboxylase OS=Solanum lycopersicum GN=ODC PE=2 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 2.079e-37
Identity = 81/156 (51.92%), Postives = 100/156 (64.10%), Query Frame = 1
Query:   43 GGQRVTTVVTKDELTEFMQSTILKRQEFDEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            G  R    ++KD L +FM S I ++ + D+ PFY++DLG VVSL     S LP I P YAVKCN            GSNFDC SR+EIE VL  G+SPDRI++ANPCKP S I +A  +GVNLTT DS +E+ KIR  HPK +LL+RIK   D  A
Sbjct:   33 GHTRKVVPLSKDALQDFMVSIITQKLQDDKQPFYVLDLGEVVSLMEQWNSALPNIRPFYAVKCNPEPSFLSMLSAMGSNFDCASRAEIEYVLSHGISPDRIVFANPCKPESDIIFAEKIGVNLTTYDSEDEVYKIRKHHPKCELLLRIKPMTDGNA 188          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_CAPAN (Ornithine decarboxylase OS=Capsicum annuum GN=ODC PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.946e-35
Identity = 79/170 (46.47%), Postives = 105/170 (61.76%), Query Frame = 1
Query:    1 GTPSTLLHLDAQVMGGQRVTTVVTKDELTEFMQSTILKRQEFDEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            G P +     A+     R    ++KD L +FM S I ++ + ++ PFY++DLG VVSL +     LP + P YAVKCN            GSNF C SR+EIE VL LG+SP+RI++ANPCKP S I +A  VGVNLTT DS +E+ KI+  HPK +LL+RIK  +D  A
Sbjct:   23 GAPPSTAAAAAENGDTTRKVVPLSKDALQDFMVSIITQKLQGEKKPFYVLDLGEVVSLMDQWNVALPNVRPFYAVKCNPEPSFLSMLAAMGSNFVCASRAEIEYVLSLGISPERIVFANPCKPESDIIFAEKVGVNLTTYDSEDEVYKIKKHHPKCELLLRIKPMNDGNA 192          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_YEAST (Ornithine decarboxylase OS=Saccharomyces cerevisiae GN=SPE1 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.555e-29
Identity = 62/126 (49.21%), Postives = 82/126 (65.08%), Query Frame = 1
Query:  127 DEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDS 504
            +E  F++ DLG V  L+N+ +  LP I P YAVKCN            G NFDC S+ EI+ VL + +SPDRI+YANPCK  S I+YAAS  V  +T D+VEEL KI+ +HP+S LL+RI + D +
Sbjct:   83 EENSFFICDLGEVKRLFNNWVKELPRIKPFYAVKCNPDTKVLSLLAELGVNFDCASKVEIDRVLSMNISPDRIVYANPCKVASFIRYAASKNVMKSTFDNVEELHKIKKFHPESQLLLRIATDDST 208          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_DICDI (Probable ornithine decarboxylase OS=Dictyostelium discoideum GN=odc PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.930e-28
Identity = 58/126 (46.03%), Postives = 85/126 (67.46%), Query Frame = 1
Query:  127 DEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDS 504
            D   F++ D+GV++  +   + NLP + P+YAVKCN            G+N+DC SR+EIE+VL LGV P RIIYANPCK +S +K+A +  V L T D++ EL+KI  + P+++L++RI +PDDS
Sbjct:   83 DRDAFFVADVGVIIKQWQKWVKNLPNVKPYYAVKCNPTVGVLRVLDALGTNYDCASRTEIESVLNLGVDPSRIIYANPCKQISALKFARAHNVKLMTFDNLSELEKIEKFFPEAELVLRI-APDDS 207          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_SCHPO (Ornithine decarboxylase OS=Schizosaccharomyces pombe GN=spe1 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 4.345e-27
Identity = 60/141 (42.55%), Postives = 86/141 (60.99%), Query Frame = 1
Query:   88 EFMQSTILKRQEFDEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            E ++   ++ +  D   F++ DL  V        + LP + P YAVKCN            G+ FDC S+ E+E +L LGVSPDRI+YANPCK +++++YAAS G+NL T D+ +EL K++  HP S LL+RI S DDS +
Sbjct:   52 EEIERAAVRGEPADSDAFFVADLNGVYRQLLRWHAKLPRVQPFYAVKCNPDPKVLALLNKFGTGFDCASKGELEQILGLGVSPDRIVYANPCKAITYVRYAASKGINLMTFDNADELYKVKQHHPNSRLLLRI-STDDSNS 191          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_RAT (Ornithine decarboxylase OS=Rattus norvegicus GN=Odc1 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 8.195e-26
Identity = 63/128 (49.22%), Postives = 80/128 (62.50%), Query Frame = 1
Query:  127 DEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            D+  FY+ DLG V+  +   +  LP + P YAVKCN            G+ FDC S++EI+ V  LGV P+RIIYANPCK VS IKYAAS GV + T DS  EL K+   HPK+ L++RI + DDS A
Sbjct:   36 DKDAFYVADLGDVLKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPPERIIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRI-ATDDSKA 162          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_MUSPA (Ornithine decarboxylase OS=Mus pahari GN=Odc1 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 8.195e-26
Identity = 62/128 (48.44%), Postives = 80/128 (62.50%), Query Frame = 1
Query:  127 DEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            D+  FY+ DLG ++  +   +  LP + P YAVKCN            G+ FDC S++EI+ V  LGV P+RIIYANPCK VS IKYAAS GV + T DS  EL K+   HPK+ L++RI + DDS A
Sbjct:   36 DKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAATGTGFDCASKTEIQLVQGLGVPPERIIYANPCKQVSQIKYAASSGVQMMTFDSEIELMKVARAHPKAKLVLRI-ATDDSKA 162          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_HUMAN (Ornithine decarboxylase OS=Homo sapiens GN=ODC1 PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.070e-25
Identity = 61/128 (47.66%), Postives = 80/128 (62.50%), Query Frame = 1
Query:  127 DEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            D+  FY+ DLG ++  +   +  LP + P YAVKCN            G+ FDC S++EI+ V  LGV P+RIIYANPCK VS IKYAA+ GV + T DS  EL K+   HPK+ L++RI + DDS A
Sbjct:   36 DKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRI-ATDDSKA 162          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_BOVIN (Ornithine decarboxylase OS=Bos taurus GN=ODC1 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.070e-25
Identity = 61/128 (47.66%), Postives = 80/128 (62.50%), Query Frame = 1
Query:  127 DEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            D+  FY+ DLG ++  +   +  LP + P YAVKCN            G+ FDC S++EI+ V  LGV P+RIIYANPCK VS IKYAA+ GV + T DS  EL K+   HPK+ L++RI + DDS A
Sbjct:   36 DKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRI-ATDDSKA 162          
The following BLAST results are available for this feature:
BLAST of CF503812 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
DCOR_DATST1.440e-3852.94Ornithine decarboxylase OS=Datura stramonium PE=2 ... [more]
DCOR_SOLLC2.079e-3751.92Ornithine decarboxylase OS=Solanum lycopersicum GN... [more]
DCOR_CAPAN1.946e-3546.47Ornithine decarboxylase OS=Capsicum annuum GN=ODC ... [more]
DCOR_YEAST3.555e-2949.21Ornithine decarboxylase OS=Saccharomyces cerevisia... [more]
DCOR_DICDI3.930e-2846.03Probable ornithine decarboxylase OS=Dictyostelium ... [more]
DCOR_SCHPO4.345e-2742.55Ornithine decarboxylase OS=Schizosaccharomyces pom... [more]
DCOR_RAT8.195e-2649.22Ornithine decarboxylase OS=Rattus norvegicus GN=Od... [more]
DCOR_MUSPA8.195e-2648.44Ornithine decarboxylase OS=Mus pahari GN=Odc1 PE=2... [more]
DCOR_HUMAN1.070e-2547.66Ornithine decarboxylase OS=Homo sapiens GN=ODC1 PE... [more]
DCOR_BOVIN1.070e-2547.66Ornithine decarboxylase OS=Bos taurus GN=ODC1 PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-298 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_A11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503812 ID=CF503812|Name=CF503812|organism=Citrus sinensis|type=EST|length=511bp
GGAACTCCAAGCACATTATTGCATTTGGATGCACAAGTAATGGGAGGCCA
GAGAGTCACGACGGTGGTAACAAAAGATGAGCTAACTGAATTCATGCAGT
CAACAATCTTGAAGAGACAAGAGTTCGATGAAGTACCCTTTTACCTAATG
GATTTAGGCGTTGTGGTTTCTCTCTACAATCATATGATCTCAAACCTTCC
GATGATTCATCCTCACTATGCCGTCAAGTGCAATCCCGAGCCAGCCCTTC
TCGAGGCACTTGCAGCTCTTGGCTCAAACTTTGACTGTGGAAGCCGATCC
GAGATTGAAGCTGTTTTGTTACTAGGTGTTTCACCGGATCGTATCATTTA
CGCAAACCCGTGTAAGCCTGTATCTCACATCAAGTATGCTGCGAGTGTTG
GCGTCAACTTGACAACCGTTGACTCAGTAGAGGAGCTCGACAAGATTCGG
AACTGGCATCCGAAATCTGATTTATTGATCAGGATCAAATCCCCGGATGA
TAGCGGAGCGA
back to top