CF503815

Overview
NameCF503815
Unique NameCF503815
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length320
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig499 contig Csv1_Contig499:1..320. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: PHOT2_ARATH (Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2)

HSP 1 Score: 158.688 bits (400), Expect = 9.928e-46
Identity = 70/80 (87.50%), Postives = 77/80 (96.25%), Query Frame = 1
Query:   79 KPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKD 318
            +P CPI+YASSGFF+MTGYSSKE++GRNCRFLQGP+TDKNEV KIRD V+NGKSYCGRLLNYKKDGTPFWNLLTVTPIKD
Sbjct:  142 QPHCPIVYASSGFFTMTGYSSKEIVGRNCRFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNLLTVTPIKD 221          

HSP 2 Score: 46.2098 bits (108), Expect = 9.928e-46
Identity = 22/25 (88.00%), Postives = 24/25 (96.00%), Query Frame = 3
Query:    3 FPRVSEELKAALATLQQTFVVSDAT 77
            FPRVS+ELK AL+TLQQTFVVSDAT
Sbjct:  117 FPRVSQELKTALSTLQQTFVVSDAT 141          

HSP 3 Score: 99.3673 bits (246), Expect = 6.006e-21
Identity = 44/93 (47.31%), Postives = 63/93 (67.74%), Query Frame = 1
Query:   40 QHCSKHLLCLMPPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKD 318
            +   K+ +   P  PD PI++AS  F  +T YS +E++GRNCRFLQGPETD+  V+KIRDA+R+ +    +L+NY K G  FWNL  + P++D
Sbjct:  385 ERIEKNFVISDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLFHLQPMRD 477          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: PHOT1_ARATH (Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.019e-36
Identity = 58/80 (72.50%), Postives = 69/80 (86.25%), Query Frame = 1
Query:   79 KPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKD 318
            KPD PIMYAS+GFF+MTGY+SKEV+GRNCRFLQG  TD +E+ KIR+ +  G +YCGR+LNYKKDGT FWNLLT+ PIKD
Sbjct:  206 KPDYPIMYASAGFFNMTGYTSKEVVGRNCRFLQGSGTDADELAKIRETLAAGNNYCGRILNYKKDGTSFWNLLTIAPIKD 285          

HSP 2 Score: 41.5874 bits (96), Expect = 2.019e-36
Identity = 20/24 (83.33%), Postives = 22/24 (91.67%), Query Frame = 3
Query:    6 PRVSEELKAALATLQQTFVVSDAT 77
            PRVSE+LK AL+T QQTFVVSDAT
Sbjct:  182 PRVSEDLKDALSTFQQTFVVSDAT 205          

HSP 3 Score: 94.3597 bits (233), Expect = 1.932e-19
Identity = 42/93 (45.16%), Postives = 60/93 (64.52%), Query Frame = 1
Query:   40 QHCSKHLLCLMPPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIKD 318
            +   K+ +   P  PD PI++AS  F  +T YS +E++GRNCRFLQGPETD   V+KIR+A+ N      +L+NY K G  FWN+  + P++D
Sbjct:  471 ERIEKNFVITDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDLTTVKKIRNAIDNQTEVTVQLINYTKSGKKFWNIFHLQPMRD 563          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: LOVHK_PSEU2 (Blue-light-activated protein OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_2700 PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.024e-20
Identity = 41/80 (51.25%), Postives = 58/80 (72.50%), Query Frame = 1
Query:   73 PPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPI 312
            P +PD PI++A+  F  MTGY+S+E+IG NCRFLQGP+TD+  V+ IRDA+         +LNY+KDG+ FWN L ++P+
Sbjct:   40 PNRPDNPIIFANRAFLEMTGYASEEIIGSNCRFLQGPDTDRTAVQSIRDAIDQRVDISTEILNYRKDGSSFWNALFISPV 119          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: LVHK1_ERYLH (Blue-light-activated histidine kinase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_02980 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.893e-20
Identity = 40/85 (47.06%), Postives = 59/85 (69.41%), Query Frame = 1
Query:   61 LCLMPP-KPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPI 312
            +C+  P +PDCP++Y +  F  +TGY+ +E++GRNCRFLQG +TD  +V K+R+ +   +     LLNY+KDG PFWN + V PI
Sbjct:   50 ICISDPHQPDCPVVYVNQAFLDLTGYAREEIVGRNCRFLQGADTDPEQVRKLREGIAAERYTVVDLLNYRKDGIPFWNAVHVGPI 134          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: LOVHK_PSESM (Blue-light-activated protein OS=Pseudomonas syringae pv. tomato GN=PSPTO_2896 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.932e-19
Identity = 37/80 (46.25%), Postives = 57/80 (71.25%), Query Frame = 1
Query:   73 PPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPI 312
            P +PD PI++++  F  MTGY+++E++G NCRFLQGP+TD   V+ IRDA+         ++NY+KDG+ FWN L ++P+
Sbjct:   40 PNRPDNPIIFSNRAFLEMTGYTAEEILGTNCRFLQGPDTDPAVVQSIRDAIAQRNDISAEIINYRKDGSSFWNALFISPV 119          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: LOVHK_PSE14 (Blue-light-activated protein OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_2483 PE=3 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 2.523e-19
Identity = 40/80 (50.00%), Postives = 57/80 (71.25%), Query Frame = 1
Query:   73 PPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPI 312
            P + D PI++++  F  MTGYSS+E+IG NCRFLQGPETD+  V+ IR+A+         +LNY+KDG+ FWN L ++P+
Sbjct:   40 PNRADNPIIFSNRAFLEMTGYSSEEIIGTNCRFLQGPETDRAVVQSIREAIDERVDISTEILNYRKDGSTFWNALFISPV 119          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: PHOT_BACSU (Blue-light photoreceptor OS=Bacillus subtilis GN=pfyP PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.252e-18
Identity = 40/81 (49.38%), Postives = 56/81 (69.14%), Query Frame = 1
Query:   73 PPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIK 315
            P   D PI+Y + GF  MTGY ++E++G+NCRFLQG  TD  EV+ IR A++N +    ++ NYKKDGT FWN L + P++
Sbjct:   32 PALEDNPIVYVNQGFVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPME 112          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: LOVHK_OCHA4 (Blue-light-activated histidine kinase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=Oant_3652 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.790e-18
Identity = 42/86 (48.84%), Postives = 57/86 (66.28%), Query Frame = 1
Query:   58 LLCLMPPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPIK 315
            +L   P  PD PI++A+  F ++TGY + E+IG+NCRFLQGP TD   VE I  A+   +S    +LNYKK G PFWN L ++P+K
Sbjct:   34 MLITNPRLPDNPIIFANEAFQNLTGYEADEIIGKNCRFLQGPGTDPKHVEIIHSALEAEQSVEIDILNYKKSGEPFWNRLHISPVK 119          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: PHOT_LISMO (Blue-light photoreceptor OS=Listeria monocytogenes GN=lmo0799 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.261e-17
Identity = 44/83 (53.01%), Postives = 58/83 (69.88%), Query Frame = 1
Query:   73 PPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLL-NYKKDGTPFWNLLTVTPIKD 318
            P + D PI++ ++GF ++TGY+ +E +G NC FLQG +TDK EV KIR A+ N KS    LL NY+KDGT F N LT+ PI D
Sbjct:   26 PEQKDNPIIFVNTGFENITGYAKEEALGSNCHFLQGDDTDKEEVAKIRHAI-NEKSTANVLLKNYRKDGTSFMNELTIEPIYD 107          
BLAST of CF503815 vs. ExPASy Swiss-Prot
Match: TLOV1_ARATH (Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.999e-16
Identity = 36/84 (42.86%), Postives = 60/84 (71.43%), Query Frame = 1
Query:   73 PPKPDCPIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNY--KKDGTPFWNLLTVTPIKD 318
            P  PD PI+YAS  F ++TGY  +EV+G+NCRFL G +TD + + ++++ +  G+S   ++LNY  +KD + FWNLL ++P+++
Sbjct:  266 PCLPDMPIIYASDAFLTLTGYKRQEVLGQNCRFLSGVDTDSSVLYEMKECILKGQSCTVQILNYSNRKDKSSFWNLLHISPVRN 349          

HSP 2 Score: 83.5741 bits (205), Expect = 3.410e-16
Identity = 37/74 (50.00%), Postives = 53/74 (71.62%), Query Frame = 1
Query:   91 PIMYASSGFFSMTGYSSKEVIGRNCRFLQGPETDKNEVEKIRDAVRNGKSYCGRLLNYKKDGTPFWNLLTVTPI 312
            PI++AS GF  MTGYS +EVIGRN +  QGP+T++  + +IR+A+R  +S    LLNY+K G+PFW L  + P+
Sbjct:   50 PIVFASLGFLKMTGYSREEVIGRNGKVFQGPKTNRRSIMEIREAIREERSVQVSLLNYRKSGSPFWMLFHMCPV 123          
The following BLAST results are available for this feature:
BLAST of CF503815 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
PHOT2_ARATH9.928e-4687.50Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=... [more]
PHOT1_ARATH2.019e-3672.50Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=... [more]
LOVHK_PSEU21.024e-2051.25Blue-light-activated protein OS=Pseudomonas syring... [more]
LVHK1_ERYLH3.893e-2047.06Blue-light-activated histidine kinase 1 OS=Erythro... [more]
LOVHK_PSESM1.932e-1946.25Blue-light-activated protein OS=Pseudomonas syring... [more]
LOVHK_PSE142.523e-1950.00Blue-light-activated protein OS=Pseudomonas syring... [more]
PHOT_BACSU1.252e-1849.38Blue-light photoreceptor OS=Bacillus subtilis GN=p... [more]
LOVHK_OCHA42.790e-1848.84Blue-light-activated histidine kinase OS=Ochrobact... [more]
PHOT_LISMO5.261e-1753.01Blue-light photoreceptor OS=Listeria monocytogenes... [more]
TLOV1_ARATH1.999e-1642.86Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-302 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_B03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503815 ID=CF503815|Name=CF503815|organism=Citrus sinensis|type=EST|length=320bp
CATTCCCAAGGGTTTCAGAGGAGTTGAAGGCTGCATTGGCAACATTGCAG
CAAACATTTGTTGTGTCTGATGCCACCTAAACCTGACTGCCCTATAATGT
ATGCCAGCAGTGGCTTTTTTAGCATGACTGGTTACTCTTCCAAGGAGGTC
ATTGGAAGGAATTGCCGGTTTCTTCAAGGGCCAGAAACAGACAAGAATGA
GGTGGAGAAAATACGAGATGCGGTGAGGAACGGGAAGAGTTACTGCGGCA
GGCTCTTGAACTACAAAAAAGATGGTACTCCTTTCTGGAATCTACTCACT
GTTACGCCTATCAAGGATGA
back to top