CF503816

Overview
NameCF503816
Unique NameCF503816
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length291
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1066 contig Csv1_Contig1066:365..655. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PC_MAGLI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.241e-45
Identity = 85/89 (95.51%), Postives = 86/89 (96.63%), Query Frame = 1
Query:   25 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            K+KIGINGFGRIGRLVARV LQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKD KTLLFGEKPVTVFGVRNPEEIPW E
Sbjct:    5 KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDSKTLLFGEKPVTVFGVRNPEEIPWGE 93          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PC_RANAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ranunculus acris GN=GAPC PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 6.158e-45
Identity = 83/90 (92.22%), Postives = 86/90 (95.56%), Query Frame = 1
Query:   22 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            GK+KIGINGFGRIGRLVARV L RDDVELVAVNDPFITTDYMTYMFKYD+VHGQWKHHELKVKD+KTLLFGEKPVTVFG RNPEEIPW E
Sbjct:    3 GKIKIGINGFGRIGRLVARVALARDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHELKVKDEKTLLFGEKPVTVFGCRNPEEIPWGE 92          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PC_PETHY (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 8.042e-45
Identity = 82/91 (90.11%), Postives = 86/91 (94.51%), Query Frame = 1
Query:   19 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            M K+KIGINGFGRIGRLVARV LQRDDVELVAVNDPFI+ +YMTYMFKYDSVHGQWKHHELK KDDKTLLFGEKPVTVFG+RNPEEIPW E
Sbjct:    1 MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKHHELKAKDDKTLLFGEKPVTVFGIRNPEEIPWGE 91          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PC_ARATH (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Arabidopsis thaliana GN=GAPC PE=2 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 1.372e-44
Identity = 80/89 (89.89%), Postives = 89/89 (100.00%), Query Frame = 1
Query:   25 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            K++IGINGFGRIGRLVARV+LQRDDVELVAVNDPFITT+YMTYMFKYDSVHGQWKH+ELK+KD+KTLLFGEKPVTVFG+RNPE+IPWAE
Sbjct:    5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTVFGIRNPEDIPWAE 93          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3P_ATRNU (Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.056e-44
Identity = 82/91 (90.11%), Postives = 86/91 (94.51%), Query Frame = 1
Query:   19 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            M KVKIGINGFGRIGRLVARVILQ DD ELVA+NDPFITTDYMTYMFKYDSVHGQWKHHELKVKD+KTLLFGE+PVTVFG RNPEEIPW +
Sbjct:    1 MAKVKIGINGFGRIGRLVARVILQSDDCELVAINDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGERPVTVFGNRNPEEIPWGQ 91          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PC_SINAL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 3.991e-44
Identity = 81/89 (91.01%), Postives = 88/89 (98.88%), Query Frame = 1
Query:   25 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            K+KIGINGFGRIGRLVARVILQR+DVELVAVNDPFITT+YMTYMFKYDSVHGQWKH+ELKVKD+KTLLFGEKPVTVFG+RNPE+IPW E
Sbjct:    5 KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKVKDEKTLLFGEKPVTVFGIRNPEDIPWGE 93          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PX_HORVU (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Hordeum vulgare GN=GAPC PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.517e-43
Identity = 80/91 (87.91%), Postives = 86/91 (94.51%), Query Frame = 1
Query:   19 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            MGK+KIGINGFGRIGRLVARV LQ DDVELVAVNDPFITT+YMTYMFKYD+VHG WKH ++K+KDDKTLLFGEKPVTVFGVRNPEEIPW E
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTEYMTYMFKYDTVHGHWKHSDIKLKDDKTLLFGEKPVTVFGVRNPEEIPWGE 91          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PC_ORYSJ (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 5.763e-43
Identity = 78/91 (85.71%), Postives = 86/91 (94.51%), Query Frame = 1
Query:   19 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYMFKYD+VHGQWKH ++K+KD KTLL GEKPVTVFG+RNP+EIPWAE
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAE 91          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PC_ORYSI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Oryza sativa subsp. indica GN=GAPC PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 5.763e-43
Identity = 78/91 (85.71%), Postives = 86/91 (94.51%), Query Frame = 1
Query:   19 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYMFKYD+VHGQWKH ++K+KD KTLL GEKPVTVFG+RNP+EIPWAE
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAE 91          
BLAST of CF503816 vs. ExPASy Swiss-Prot
Match: G3PD_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 2 OS=Zea mays GN=GAPC2 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.284e-42
Identity = 78/91 (85.71%), Postives = 85/91 (93.41%), Query Frame = 1
Query:   19 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAE 291
            MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYMFKYD+VHGQWKH ++ +KD KTLLFGEKPVTVFG+RNPEEIPW E
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIALKDSKTLLFGEKPVTVFGIRNPEEIPWGE 91          
The following BLAST results are available for this feature:
BLAST of CF503816 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 182
Match NameE-valueIdentityDescription
G3PC_MAGLI1.241e-4595.51Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_RANAC6.158e-4592.22Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PETHY8.042e-4590.11Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ARATH1.372e-4489.89Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_ATRNU3.056e-4490.11Glyceraldehyde-3-phosphate dehydrogenase OS=Atripl... [more]
G3PC_SINAL3.991e-4491.01Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PX_HORVU1.517e-4387.91Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ORYSJ5.763e-4385.71Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ORYSI5.763e-4385.71Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PD_MAIZE1.284e-4285.71Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-303 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_B04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503816 ID=CF503816|Name=CF503816|organism=Citrus sinensis|type=EST|length=291bp
CCTCGTGCCGCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGGATT
CGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACGATG
TTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATGACA
TACATGTTTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGAATT
GAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCACTG
TTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAG
back to top