CF503820

Overview
NameCF503820
Unique NameCF503820
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length240
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8093 contig Csv1_Contig8093:272..511. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: TDT_ARATH (Tonoplast dicarboxylate transporter OS=Arabidopsis thaliana GN=TDT PE=2 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 6.741e-36
Identity = 71/79 (89.87%), Postives = 76/79 (96.20%), Query Frame = 2
Query:    2 RNMLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNIT 238
            RNMLGVL W+FAWWLTEAVPMPITSM PLFLFPLFGIS+AD VA+SYMDDVI+LVLGSFILALAVEHYNIH+RLALNIT
Sbjct:   73 RNMLGVLVWMFAWWLTEAVPMPITSMTPLFLFPLFGISAADDVANSYMDDVISLVLGSFILALAVEHYNIHRRLALNIT 151          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAAW (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain MW2) GN=sdcS PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAAS (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain MSSA476) GN=sdcS PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAAR (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain MRSA252) GN=sdcS PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAAN (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain N315) GN=sdcS PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAAM (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sdcS PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAAC (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain COL) GN=sdcS PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAAB (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sdcS PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAA8 (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain NCTC 8325) GN=sdcS PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
BLAST of CF503820 vs. ExPASy Swiss-Prot
Match: SDCS_STAA3 (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain USA300) GN=sdcS PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.560e-15
Identity = 34/76 (44.74%), Postives = 52/76 (68.42%), Query Frame = 2
Query:    8 MLGVLAWVFAWWLTEAVPMPITSMAPLFLFPLFGISSADTVAHSYMDDVIALVLGSFILALAVEHYNIHKRLALNI 235
            +L +  W+  WW+TEA+P+  TS+ P+ L PL  I + + V+  Y +D+I L LG FILA+A+E +N+H R+AL I
Sbjct:   62 VLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFILAIAMERWNLHTRVALTI 137          
The following BLAST results are available for this feature:
BLAST of CF503820 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
TDT_ARATH6.741e-3689.87Tonoplast dicarboxylate transporter OS=Arabidopsis... [more]
SDCS_STAAW6.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAAS6.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAAR6.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAAN6.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAAM6.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAAC6.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAAB6.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAA86.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAA36.560e-1544.74Sodium-dependent dicarboxylate transporter sdcS OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-307 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_B08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503820 ID=CF503820|Name=CF503820|organism=Citrus sinensis|type=EST|length=240bp
CAGGAACATGTTGGGTGTTCTTGCTTGGGTCTTCGCTTGGTGGCTCACGG
AGGCCGTACCCATGCCCATTACCTCTATGGCGCCTCTGTTTCTGTTTCCT
CTGTTTGGTATCTCTTCTGCTGACACCGTTGCTCATTCTTACATGGATGA
TGTTATTGCCCTCGTTCTTGGTAGCTTTATTCTTGCTCTTGCCGTTGAGC
ACTACAACATTCACAAAAGATTGGCCTTAAATATAACCTA
back to top